DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and FY

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001318555.1 Gene:FY AraportID:AT5G13480 Length:657 Species:Arabidopsis thaliana

Alignment Length:414 Identity:72/415 (17%)
Similarity:140/415 (34%) Gaps:105/415 (25%)


  Fly   153 RTVDADTQTMTALMKSRLVNTERL-TTAQMGSYVSNFEMYDTYTDLEKSTTSVQ----------- 205
            ||...|::..|.|..:.....:.| |.|...:..::|.....:..|.|:..|:.           
plant    85 RTWQRDSRDRTTLQPTPAAAVDMLPTVAYSDNPSTSFAAKFVHASLNKNRCSINRVLWTPSGRRL 149

  Fly   206 VQGAKKMEITTYHVGGVDQFVGINCLPGFRLALMLTMRILASNVFEPQQRRYRNMAPPDPLAEDV 270
            :.|::..|.|.::....:          |.:.|....:.:.|.|:...:   ..|...|   :..
plant   150 ITGSQSGEFTLWNGQSFN----------FEMILQAHDQPIRSMVWSHNE---NYMVSGD---DGG 198

  Fly   271 KFKYRLGLLWR--LSPPSSDPKVH-QAVSDMSFCPSNGDIMAVAYGVYSHGKVSKLPRSGWVYVW 332
            ..||     |:  ::...::...| :::.|:|||.:  |:           |.........|.||
plant   199 TLKY-----WQNNMNNVKANKTAHKESIRDLSFCKT--DL-----------KFCSCSDDTTVKVW 245

  Fly   333 NIKNPVNPERRYHYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRDI-SGQDLPPLAVSQRLSSPYF 396
            :....|:......:...|.:|::.||: .||..|..:..|::.|. ||::|..|...:.:     
plant   246 DFTKCVDESSLTGHGWDVKSVDWHPTK-SLLVSGGKDQLVKLWDTRSGRELCSLHGHKNI----- 304

  Fly   397 EPVTAIKWIYFEGDVGCRNPHITPFLATSQAGAVTKYRLINSPNMLGLEQQRLQRAEGELEGIPI 461
              |.::||          |.:....|..|:...:..|.:        ...:.||...|..:.:  
plant   305 --VLSVKW----------NQNGNWLLTASKDQIIKLYDI--------RTMKELQSFRGHTKDV-- 347

  Fly   462 ERQPPAASLLANRHPQCLEIVLDPVQSDIYYVLTDEGTLYKCSTNYPLQHLELRQVHDGPAACME 526
                             ..:...|...:.:...:.:|::......:....:|:...||.....: 
plant   348 -----------------TSLAWHPCHEEYFVSGSSDGSICHWIVGHENPQIEIPNAHDNSVWDL- 394

  Fly   527 FSPWSPRMYLTC-GSD------WC 543
              .|.|..||.| ||:      ||
plant   395 --AWHPIGYLLCSGSNDHTTKFWC 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 49/277 (18%)
WD40 repeat 295..344 CDD:293791 10/49 (20%)
WD40 repeat 350..397 CDD:293791 13/48 (27%)
WD40 repeat 400..473 CDD:293791 9/73 (12%)
WD40 repeat 478..513 CDD:293791 2/35 (6%)
WD40 <518..>593 CDD:295369 11/34 (32%)
WD40 repeat 524..560 CDD:293791 9/28 (32%)
FYNP_001318555.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.