DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and dic1

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001342791.1 Gene:dic1 PomBaseID:SPBC646.17c Length:544 Species:Schizosaccharomyces pombe

Alignment Length:588 Identity:114/589 (19%)
Similarity:224/589 (38%) Gaps:124/589 (21%)


  Fly   105 KVLLRKTPIVVLFERRSMT--ALADTEEG-RQVMED--NRKYDELLSGTDKTRRTVDADTQTMTA 164
            ::.:::..:::|..:.:.|  ..:..:|| :|:.||  :....::|..|:.|.:|...::::   
pombe     8 EIEIKRAKLLLLKNKENCTDAVSSSNKEGPKQISEDQLSNFLCKILKPTNLTPQTYSLESKS--- 69

  Fly   165 LMKSRLVNTERLTTAQM-GSYVSNFEMYDTYTDLEKST----TSVQVQGAKKMEITTYHVGGVDQ 224
               |.||:...|..:.: .||.|.|.:.:....:.|:.    ||..::.:.|....:.....:: 
pombe    70 ---SNLVSDCELKISSVYQSYSSTFNVSNHVPSISKTVNIRETSKHLKHSTKAPKCSLPTSALE- 130

  Fly   225 FVGINCLPGFRLALMLTMRIL-------ASNVFEPQQRRYRNMAPPDPLAEDVKFKYRLGLLWRL 282
               |:.|..|   |..:.:||       ::.:|.....:.::......|.|:       ||....
pombe   131 ---IDHLNNF---LHSSAKILDRALCDQSNQLFTDYTVKKKSKKNKSQLEEN-------GLNHLF 182

  Fly   283 SPPSSDPKVHQAVSDMSFCPSNGDIMAVAYGVYSHGKVSKLPRS-GWVYVWNIKNPVNPERRYHY 346
            :.......::..|:.:|:.....:::     :.|:.|..:..|: |...|||.:...:||.....
pombe   183 TFQDEKITLNSVVNSISYSSFFEELL-----ITSYAKPKEALRTRGLAIVWNQRWKNSPESVLKA 242

  Fly   347 QVPVVTVEFSPTQPQLLAIGLHNGGVEVRDISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEGDV 411
            :..:...:.||..|||:|.|.:||.|.:.|:. |...|::.:..:|..:.||||.|.:|      
pombe   243 RSEITVCKPSPFHPQLIAGGAYNGQVFLWDLR-QGQYPVSFTTIISGGHLEPVTDITYI------ 300

  Fly   412 GCRNPHITPFLATSQAGAVTKYRLINSPNMLGLEQQRL---QRAEGELEGIPIERQPPAASLLAN 473
              .||.....:..|..|.|.    |..|:|.....:.:   .:.:...:.||             
pombe   301 --NNPPSNNIVTCSTDGLVH----IWEPDMFSRPSETICLSSQVDSSSQCIP------------- 346

  Fly   474 RHPQCLEIVLDPVQSDIYYVLTDEGTLYKCSTNYPLQHLELRQV------HDGPAACME------ 526
              ..||..:  |..:..:.|..::|.|.:   .|...:.|.:.|      ::|....:.      
pombe   347 --ATCLSFI--PENNMEFLVGAEDGKLQR---GYRSDYSETKAVQPSNVSYEGHNVFISGIDVMT 404

  Fly   527 ------FSPWSPRMYLTCGSDWCIRIWLAG------ILLPIVTLQH-----------HLSPVHCA 568
                  |...:....||...||.:|:|...      .|:|...|..           |.:.|...
pombe   405 SNSQNVFLEKNKDFALTSSFDWTVRLWQCSPSRNQHELVPSNDLDEQVIINSCKTFTHKAMVFDV 469

  Fly   569 RWSRTHSTILVSL-SRSTVDIWDLRNSTMKPVSSTVIDA----DIFYTTFKFTHCGRSLAVGNEA 628
            :|..:......|: :...:::|||:.....||:|.:.|.    .|.:...|     |:||.|...
pombe   470 KWCVSEPCCFASVDALGNLNLWDLQKDVEAPVTSDIPDGKPLNKIAWQPEK-----RNLACGGLN 529

  Fly   629 GNL 631
            ||:
pombe   530 GNV 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 80/398 (20%)
WD40 repeat 295..344 CDD:293791 11/50 (22%)
WD40 repeat 350..397 CDD:293791 14/47 (30%)
WD40 repeat 400..473 CDD:293791 13/76 (17%)
WD40 repeat 478..513 CDD:293791 7/35 (20%)
WD40 <518..>593 CDD:295369 18/105 (17%)
WD40 repeat 524..560 CDD:293791 10/54 (19%)
dic1NP_001342791.1 WD40 223..536 CDD:330360 75/349 (21%)
WD40 repeat 247..289 CDD:293791 14/43 (33%)
WD40 repeat 294..339 CDD:293791 12/57 (21%)
WD40 repeat 348..390 CDD:293791 9/47 (19%)
WD40 repeat 397..453 CDD:293791 10/56 (18%)
WD40 repeat 466..504 CDD:293791 9/38 (24%)
WD40 repeat 511..535 CDD:293791 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.