DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and dnai1.2

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001074027.1 Gene:dnai1.2 ZFINID:ZDB-GENE-070112-1302 Length:660 Species:Danio rerio

Alignment Length:662 Identity:138/663 (21%)
Similarity:250/663 (38%) Gaps:150/663 (23%)


  Fly    68 QLDTPMSPTLEEPNYLKEPASSARSAHSARPPATPF--------IKVLLRKTPIVVLFERRSMTA 124
            |||.    |.||   |||..:...:|::...|....        .|.::....:.:.||......
Zfish    63 QLDL----TEEE---LKEEITRVLTANNPNAPQNVVRYSFKEGCYKTIVFVDQMAIHFELEGNLV 120

  Fly   125 LADTEEGRQVMEDNRKY-----DELLS------GTDKTRRT-----VDADTQTMTALMKSRLVNT 173
            ..:::|||::|..:.:.     ||.|.      |..:.:.|     :|..:||:..|.:.....|
Zfish   121 HKESDEGRRLMAKHTEREDCGGDERLENVPIKPGKREQKVTNQFNFIDRASQTLNNLPREISCQT 185

  Fly   174 ERLTTAQMGSYVSNFEMYDTYTD----LEKSTTSVQVQ--------GAKKMEITTYHVGGVDQFV 226
            |....|...:..:.:|:||.|.:    .|||....:.|        ..|||.........:.|..
Zfish   186 EPPPRANFSATANQWEIYDFYVEELQRREKSKEKQESQFPNKEEDRSKKKMIQAEAQSDDISQLA 250

  Fly   227 GINCLPGFRLALMLTMRILASNVFEPQQRRYRNMAPPDPLAEDVKF-----------KYRLGLLW 280
                     ....:..|::..|:|             |.:|:|..:           |..|..||
Zfish   251 ---------KPAEIIERMVNQNIF-------------DEVAQDFMYFEDAADEFRGEKGTLLPLW 293

  Fly   281 RLSPPSSDPKVHQAVSDMSFCPSN--GDIMAVAYGVYSHGKVSKLPRSGWVYVWNIKNPVNPERR 343
            :.....:     :.:|..:.|.::  .|:.||..|.|...:..:    |.:..:.:|||..||..
Zfish   294 KFQYDKA-----KGLSVTALCWNHIYSDLFAVGLGSYEFTQQER----GMLLFYTLKNPSFPEFI 349

  Fly   344 YHYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRDISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFE 408
            ::....|:.|:.......|:|:||::|.|.|.|:..:...|:..|...|..:...|..:||...:
Zfish   350 FNTDSGVMCVDIHEQLSYLVAVGLYDGCVSVYDLRKKSDQPMYNSIASSGKHTGAVWQVKWQKDD 414

  Fly   409 GDVGCRNPHITPFLATSQAGAVTKYRLINSPNMLGLEQQRLQRAEGELEGIPIERQPPAASLLAN 473
            .|    :.|  .|.:.|..|.|..:.|:                :.|:....|.:.||     .:
Zfish   415 LD----SNH--NFFSVSTDGRVVSWTLV----------------KHEIVFTDIIKLPP-----VD 452

  Fly   474 RHPQCLEIVLDPV--------QSDIYYVL-TDEGTLYKCSTNYPLQHLELRQVHDGPAACMEFSP 529
            :.|..|:.|:...        |.|.:::: |:.|.::|.|..|..:.||:...|....:|:.::|
Zfish   453 KVPDDLKNVVATAGTSLDFHKQKDHHFLVGTEAGKIHKGSKYYSSKFLEMYDAHFMTVSCVRWNP 517

  Fly   530 WSPRMYLTCGSDWCIRIWLAGILLPIVTLQHHLSPVHCARWSRTHSTILVSLSR-STVDIWDLR- 592
            :.|.::::||.||.::||...|..|:.|.:...|....| ||...||:..:::. ..|.::||. 
Zfish   518 FHPNVFISCGWDWMVKIWDHTINSPVFTFELKSSVTDVA-WSPHSSTVFAAVTADGKVHVFDLSI 581

  Fly   593 NSTMKPVSSTVIDADIFYTTFKFTHCGRSLAVGNEAGNLLMLSFEDMPFPPHFQYKQLKRAIFKA 657
            |.........|:.........:|......:.||::.|.::                        :
Zfish   582 NKYEALCQQKVVSKKTRLLHIEFNPVHPIIIVGDDRGRVI------------------------S 622

  Fly   658 LSMQPDLRKQVK 669
            |.:.|:|||:.|
Zfish   623 LKLSPNLRKKPK 634

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 82/382 (21%)
WD40 repeat 295..344 CDD:293791 13/51 (25%)
WD40 repeat 350..397 CDD:293791 13/47 (28%)
WD40 repeat 400..473 CDD:293791 13/73 (18%)
WD40 repeat 478..513 CDD:293791 10/44 (23%)
WD40 <518..>593 CDD:295369 22/77 (29%)
WD40 repeat 524..560 CDD:293791 12/36 (33%)
dnai1.2NP_001074027.1 WD40 <296..650 CDD:225201 86/401 (21%)
WD40 354..620 CDD:295369 67/294 (23%)
WD40 repeat 357..397 CDD:293791 11/40 (28%)
WD40 repeat 405..485 CDD:293791 20/107 (19%)
WD40 repeat 511..547 CDD:293791 12/36 (33%)
WD40 repeat 552..591 CDD:293791 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D310818at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.