DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and sw

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_477075.2 Gene:sw FlyBaseID:FBgn0003654 Length:663 Species:Drosophila melanogaster

Alignment Length:708 Identity:139/709 (20%)
Similarity:250/709 (35%) Gaps:209/709 (29%)


  Fly   109 RKTPIVVLFE----RRSMTALADTEE-------GRQVMEDNRK-YDELLSG-------------T 148
            :|..:..|.|    ||....:.|.||       |..:.:|.|| .||:||.             :
  Fly    10 KKAKLAALREEKDRRRREKEIKDMEEAAGRIGGGAGIDKDQRKDLDEMLSSLGVAPVSEVLSSLS 74

  Fly   149 DKTRRTVD-ADTQTMTALM-----------------------------KSRLVNTERLTTAQMG- 182
            .....|.| ::|||..|.:                             |..||.|::..|...| 
  Fly    75 SVNSMTSDNSNTQTPDASLQATVNGQSGGKKQPLNLSVYNVQATNIPPKETLVYTKQTQTTSTGG 139

  Fly   183 --------------SYVSNF---------EMYDTY------------TDLEKSTTSVQVQG---A 209
                          .|:.::         :.||.|            ||.|:|  |:|..|   .
  Fly   140 GNGDVLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFTDDEES--SLQNLGNGFT 202

  Fly   210 KKMEITTYHVGGVDQFVGINCLPGFRLALMLTMRILASNVFEPQQRRYRNMAPP-DPLAEDVK-- 271
            .|:.                  ||:....:.|::.:|..:...:.::...:... :.|:|:.|  
  Fly   203 SKLP------------------PGYLTHGLPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQM 249

  Fly   272 ---------FKYRLG-LLWRL----------------SPPSSDPKVHQAVS----------DMSF 300
                     |..|.| ::.|.                |..::|.:.|..:|          ..:.
  Fly   250 IILSENFQRFVVRAGRVIERALSENVDIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNR 314

  Fly   301 CPSNGD----IMAVAYGVYSHGKVSKLPRSGWVYVWNIK-NPVNPERRYHYQVPVVTVEFSPTQP 360
            |.::.|    ...:..|.|.:.:.|.....|.|.|||.| ....||..:|.|..|::..|:...|
  Fly   315 CITSMDWSTHFPELVVGSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNP 379

  Fly   361 QLLAIGLHNGGVEVRDISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEGDVGCRNPHITPFLATS 425
            .|:..|.::|.:.:.|...|...|:..:...::.:..||..::.      ||.:|.|  ..::.|
  Fly   380 NLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQM------VGTQNAH--NVISIS 436

  Fly   426 QAGAVTKYRLINSPNMLGLEQQRLQRAEGELEGIPIERQPPAASLLANRHP--QCLEIVLDPVQS 488
            ..|.:..:.|    :||...|..|     ||:    :||..|.::.:...|  :...:|:.    
  Fly   437 SDGKLCSWSL----DMLSQPQDTL-----ELQ----QRQSKAIAITSMAFPANEINSLVMG---- 484

  Fly   489 DIYYVLTDEGTLYKCSTNYPLQH------LELRQVHDGPAACM-----EFSPWSPRMYLTCGSDW 542
                  :::|.:|..|     :|      .|:.:.|.||...:     :.||....::||...||
  Fly   485 ------SEDGYVYSAS-----RHGLRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDW 538

  Fly   543 CIRIWLAGILLPIVTLQHHLSPVHCARWSRTHSTILVSLSRS-TVDIWDLRNSTMKPVSSTVIDA 606
            .|::|......|:.:.:.:...|....||..|..:..::..| .:|:|:|...|..|.:|.|:..
  Fly   539 TIKLWSLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPTASIVVAG 603

  Fly   607 DIFYTTFKFTHCGRSLAVGNEAGNLLMLSF-EDMPFPPHFQYKQLKRAIFKALSMQPD 663
            ........:|..|..:.:|:|||.|.:... |::..|...::.:....:.:....|.|
  Fly   604 APALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDEWSRFNTHLSEIKMNQSD 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 87/415 (21%)
WD40 repeat 295..344 CDD:293791 14/64 (22%)
WD40 repeat 350..397 CDD:293791 9/47 (19%)
WD40 repeat 400..473 CDD:293791 16/73 (22%)
WD40 repeat 478..513 CDD:293791 5/41 (12%)
WD40 <518..>593 CDD:295369 20/81 (25%)
WD40 repeat 524..560 CDD:293791 9/41 (22%)
swNP_477075.2 Dynein_IC2 107..135 CDD:288403 5/28 (18%)
NtpH 228..>298 CDD:225368 10/70 (14%)
WD40 316..632 CDD:295369 79/352 (22%)
WD40 repeat 316..365 CDD:293791 13/49 (27%)
WD40 <344..643 CDD:225201 77/335 (23%)
WD40 repeat 371..409 CDD:293791 8/38 (21%)
WD40 repeat 418..457 CDD:293791 12/56 (21%)
WD40 repeat 469..555 CDD:293791 19/101 (19%)
WD40 repeat 561..599 CDD:293791 11/38 (29%)
WD40 repeat 607..633 CDD:293791 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60896562
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.