DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and CG13074

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_648835.1 Gene:CG13074 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster

Alignment Length:316 Identity:66/317 (21%)
Similarity:113/317 (36%) Gaps:103/317 (32%)


  Fly   130 EGRQVMEDNRKYDELLSGTDK----------TRRTVDADTQTMTALMKSRLVNTERLTTA----Q 180
            |.:..:.||      .:|||.          |:..:...|||...::.|:.|..:....|    |
  Fly    21 EKQHALVDN------CTGTDPPPPSQDAATGTQEKLHVATQTEQRVVSSKDVEYDERALAKWLRQ 79

  Fly   181 MGSYVSNFEMYDTYTDLEKSTTSVQVQGAKKMEITTYH---VGGVDQFVGINCLPGFRLALMLTM 242
            :...|.. |:.:. |.|.:..|..|.:..:|:::.||.   :||.:...|        ||:.|.:
  Fly    80 ICPMVER-ELMNP-TPLMEDLTMSQCRLEEKLQVYTYQKLIMGGAENSQG--------LAIWLCV 134

  Fly   243 R------ILASNVFEPQQRRYRNMAPPDPLAEDVKFKYRLGLLWRLSPPS----SDPKVHQAVSD 297
            .      ::|:.|           ||.|...|.|..:.:|.:..|:|..:    ::.|.....|.
  Fly   135 HTNNAPVLVATTV-----------APHDDWCEHVDQQLKLFVPQRMSVGNLVIYTEAKTLPLKSC 188

  Fly   298 M-SFC--PSN----------GDIMAVAY----GVYSHGKVSKL---------------PR----- 325
            : |.|  |.|          |::....|    |..|...:.:|               ||     
  Fly   189 LRSLCTNPFNKTMFAGSTMDGELFIWLYEQARGSDSSVDIKQLYSVSSTQGAAVALDWPREHLLL 253

  Fly   326 ----SGWVYVWNIKNPVNPERRYHYQVPVVTVEFSPTQPQLL-----AIGLHNGGV 372
                :|.|..|::...:..:  :.|.:| .||...||....|     .:|.::|||
  Fly   254 ACFANGSVRQWDLSRQMALD--WEYTLP-ATVSSEPTAMVTLGLDDFVVGTNDGGV 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 29/145 (20%)
WD40 repeat 295..344 CDD:293791 15/90 (17%)
WD40 repeat 350..397 CDD:293791 9/29 (31%)
WD40 repeat 400..473 CDD:293791
WD40 repeat 478..513 CDD:293791
WD40 <518..>593 CDD:295369
WD40 repeat 524..560 CDD:293791
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 9/45 (20%)
WD40 repeat 242..275 CDD:293791 5/35 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.