DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and CG14838

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_648138.1 Gene:CG14838 FlyBaseID:FBgn0035799 Length:1132 Species:Drosophila melanogaster

Alignment Length:795 Identity:147/796 (18%)
Similarity:278/796 (35%) Gaps:266/796 (33%)


  Fly     1 MSRPLRKDYRT----ADFEQLSRMI---RDHPLMKEPGAEQQQLHKLRTP-----EYR-TKCVMR 52
            |.|.|||..|.    ...|:::.|:   :|.|:    ..|.|.::.::.|     :|| |:    
  Fly   187 MQRRLRKKPRRWVSHGTDEEMTIMVERFKDEPI----DVEIQSVYPIQMPRHVAFDYRMTR---- 243

  Fly    53 ASLDDIALGINLYKLQLDTPMSPTLEEPNYLKEPAS-SARSAHSARPPATPFIKVLLRKTPIVVL 116
                |:..|:      |:...:..::..|..|:..: |.:||    ||.                
  Fly   244 ----DVRDGV------LELLPNENIKWENVTKKRVNVSVQSA----PPK---------------- 278

  Fly   117 FERRSMT-----ALADTEEGRQVMEDNRKYDELLSGTDKTRRTVDADTQT----------MTALM 166
            .||...|     :.|.::...::.:::.:.||.....::.::...|...|          |:|.:
  Fly   279 IEREQQTNPTFPSNAWSQYLYEIDDEDLELDETDVDEEEEKKKAQAKPGTYVEPEKKPPEMSAQI 343

  Fly   167 KSRLVNTERLTTAQMGSYVSNFEMYDT-----YTD--LEKSTTSVQVQGAKKMEITTYHVGGVDQ 224
            : .|:||  |...|:.||..::.:..:     ||:  |::......:..:.|.     .|.|.|.
  Fly   344 E-MLLNT--LEFNQIDSYRDDYSLISSRQVVQYTNPYLQEFLCFANISKSNKR-----FVAGYDW 400

  Fly   225 FVGINCLPGFRLALMLTMRI-LASNVFEPQQRRYRNMAPPDPLAEDVKFKYRLGLLWRLSPPSSD 288
            :..::.|.....|......: .|:|..:..||.   :..|:|:           |||..|...:.
  Fly   401 YPKLSGLIAVSYAFSTPATVNEATNRVDYVQRA---VLEPNPV-----------LLWSFSDNLNY 451

  Fly   289 PKVHQA---VSDMSFCPSNGDIMAVAYGVYSHGKVSKLPRSGWVYVWNIKNPVN--PERRY---- 344
            ....:|   .:.::|||.||||:...            .::|.|.:|:::....  .|..|    
  Fly   452 KLEFEAPIETTALTFCPFNGDILLGG------------SKNGQVVLWDLQGRCEKLDEEEYLTAA 504

  Fly   345 --HYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRDISGQDLPPLAVSQRLSSPYFEPVTAIKW--- 404
              .|::.:  .||.            |..:::.|   ..:.|..:|....||. ..:||..|   
  Fly   505 QAKYRIMI--GEFL------------NWTIDIED---NVIVPATISLLDCSPK-GAITAFYWLGR 551

  Fly   405 ---------IYFEGDVGCRNPHITPFLAT-------------SQAGAVTKYRLINSPNMLGLEQQ 447
                     :|.:.|:  ||.|  .|..|             .:.|...|.::.|  .||..|  
  Fly   552 SIYLSQFGKVYNDPDI--RNHH--KFFVTCAFDGTISFWDLDGKGGKSAKDKMRN--RMLPKE-- 608

  Fly   448 RLQRAEGELEGIPIER------QPPAASLLANRH-PQCLEIVLDPVQSDIYYVLTDEGTLYKCST 505
             |.::|...:.:.|:.      ..|...::|:.. ..||..|...:|::              .:
  Fly   609 -LTQSESAFKSMVIKPTYNLYFPEPITGIIADTSCLSCLTPVAKLIQAN--------------PS 658

  Fly   506 NYPLQHL-----ELRQ-------------------------------------VHDGPAACMEFS 528
            |||::.:     .:||                                     |||||...::.:
  Fly   659 NYPIKTIAKDPPTMRQSMIVSTFYGHVSRIDWQGTYTEGEATEVINSSIPFAMVHDGPVVMVKKN 723

  Fly   529 PWSPRMYLTCGSDWCIRIWLAGILLPIVTLQHHLSPVH---------CARWSRTHSTILVSLSR- 583
            |:.|.::.:.|.. .:.||..         .::.||:.         ...||.|...:|. |:| 
  Fly   724 PFYPELFASIGRT-ILAIWKE---------DYNYSPIFWRKRACDLTAVAWSETRPAVLY-LTRI 777

  Fly   584 -STVDIWDLRNSTMKPVSSTVIDADIF--YTTFKFTHCGRSLAVGNEAGNLLML----SFEDMPF 641
             ..::.||:.........:.::...|.  .|..:.:...:.|.:|:...::.|:    || |:|.
  Fly   778 DGILEAWDILARDDDACLTEILGGGIITAITEHRPSLPHKILGIGDYNSSIRMVKLPHSF-DVPL 841

  Fly   642 PPHFQYKQLKRAIFK 656
            |.  :..||.:.:.|
  Fly   842 PN--ELDQLIKYVLK 854

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 85/471 (18%)
WD40 repeat 295..344 CDD:293791 11/51 (22%)
WD40 repeat 350..397 CDD:293791 8/47 (17%)
WD40 repeat 400..473 CDD:293791 21/104 (20%)
WD40 repeat 478..513 CDD:293791 7/40 (18%)
WD40 <518..>593 CDD:295369 19/86 (22%)
WD40 repeat 524..560 CDD:293791 5/36 (14%)
CG14838NP_648138.1 WD40 328..>599 CDD:225201 63/327 (19%)
WD40 repeat 462..505 CDD:293791 12/55 (22%)
WD40 repeat 510..547 CDD:293791 10/55 (18%)
RE_R_Pab1 807..>863 CDD:286594 12/52 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60836149
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.