DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and CG9313

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001286657.1 Gene:CG9313 FlyBaseID:FBgn0034566 Length:740 Species:Drosophila melanogaster

Alignment Length:561 Identity:124/562 (22%)
Similarity:228/562 (41%) Gaps:93/562 (17%)


  Fly   136 EDNRKYDELLSGTDKTRRTVD----ADTQTMTALMKSRLVNTERL--TTAQMGSYVSNFEMYDTY 194
            ||:....:..:.:.|.|:.::    .:...:|.....|.|:|:.:  ..:|.|:.|..:.:||:|
  Fly   202 EDDEPAHQAAAVSSKKRKLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSY 266

  Fly   195 ----TDLEKSTTSVQVQGAKKMEITTYHVGGVDQFVGINCLPGFRLALMLTMRILASNVFEPQQR 255
                .:.:|..|..:.:...|.|........:.:.:....|..::    :..|::..|:::....
  Fly   267 MENFAESQKDGTKKEERKRGKREKKFRDKSAIAEQLNKKYLKCWQ----ILERMINQNIYDDIAH 327

  Fly   256 RYRNMAPPDPLAEDVKFKYRLGLLWRLSPPSSDPKVHQAVSDMSFCPSNGDIMAVAYGVYSHGKV 320
            .||..  .||..|..:.:..|..||:.   ..|......|:|:.|.||..|:.||.:|  || ..
  Fly   328 DYRYW--EDPADEFREGEGNLLPLWKF---QYDKTKKMNVTDILFNPSYYDLFAVCFG--SH-DF 384

  Fly   321 SKLPRSGWVYVWNIKNPVNPERRYHYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRDISGQDLPPL 385
            .|....|::.::.:|||..|:........|:..:..||.|.|..|||::|.|.|.::......||
  Fly   385 MKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPL 449

  Fly   386 AVSQRLSSPYFEPVTAIKW--IYFEGDVGCRNPHITPFLATSQAGAVTKYRLINSPNMLGLEQ-Q 447
            .||:.::..:.|.|..|||  ...:|:|.        |.:.|..|.|..:.|:.  |.|.:.. .
  Fly   450 YVSRGVNCKHGECVWQIKWGLDMADGEVN--------FFSVSSDGRVFNWILMQ--NKLWVTTII 504

  Fly   448 RLQRAEGELEGIPIERQPPAASLLANRHPQCLEIVLDPVQSDIYYVLTDEGTLYKCSTNYPLQHL 512
            .|.|..|.::|      |....:.......|:  |..||.:.|:.|.|:.|.:|||||.:..::|
  Fly   505 TLYRENGLVDG------PDGTKVTLKSGGSCM--VFHPVDNKIFLVGTECGYIYKCSTAFSSKYL 561

  Fly   513 ELRQVHDGPAACMEFSPWSPRMYLTCGSDWCIRIWLAGILLPIVTLQHHLSP-----------VH 566
            .....|:.....::|:.::..::::||:||.:::|            ..:.|           |.
  Fly   562 MTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVW------------EDMRPDPLFIFDLGAAVG 614

  Fly   567 CARWSRTHSTILVSL-SRSTVDIWDLRNSTMKP--VSSTVIDADIFYTTFKFTHCGRSLAVGNEA 628
            ..:|:...||:..:: :...|.::||..:..|.  :.:.|.......|...|......:.||:|.
  Fly   615 DVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEK 679

  Fly   629 GNLLMLSFEDMPFPPHFQYKQLKRAIFKALSMQPDLRKQVK 669
            |                        :..:|.:.|:||..||
  Fly   680 G------------------------VTTSLKLSPNLRMMVK 696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 91/386 (24%)
WD40 repeat 295..344 CDD:293791 17/49 (35%)
WD40 repeat 350..397 CDD:293791 15/47 (32%)
WD40 repeat 400..473 CDD:293791 17/76 (22%)
WD40 repeat 478..513 CDD:293791 14/35 (40%)
WD40 <518..>593 CDD:295369 15/87 (17%)
WD40 repeat 524..560 CDD:293791 6/36 (17%)
CG9313NP_001286657.1 WD40 <353..706 CDD:225201 95/402 (24%)
WD40 repeat 362..412 CDD:293791 17/53 (32%)
WD40 413..640 CDD:295369 62/257 (24%)
WD40 repeat 415..454 CDD:293791 14/39 (36%)
WD40 repeat 463..505 CDD:293791 13/52 (25%)
WD40 repeat 513..557 CDD:293791 15/52 (29%)
WD40 repeat 571..608 CDD:293791 7/49 (14%)
WD40 repeat 613..654 CDD:293791 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60770951
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D310818at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.