DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and CG15701

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_611100.1 Gene:CG15701 FlyBaseID:FBgn0034095 Length:1051 Species:Drosophila melanogaster

Alignment Length:801 Identity:151/802 (19%)
Similarity:254/802 (32%) Gaps:288/802 (36%)


  Fly    10 RTADFEQLSRMIRD-------------HPLMKEPGAEQQQLHKLRTPEYRTKCVMRASLDDIALG 61
            ||.|.|::..:.|:             .| :|:|.|.:.:..:.:.||..:        |..:..
  Fly   194 RTLDPEEVVILKRESAKQRSEVEAKESEP-VKQPVAFEVKFDEAKKPEPES--------DHYSDD 249

  Fly    62 INLYKLQLDTPMS-PTLEEPNYLKEPASS------ARSAHSARPPATPFIKVLLRKTPIVVLFER 119
            ...|:...:|..| |...|.:..:||:||      .|....:.|...| |.|:.|          
  Fly   250 FESYESDFETDASTPDEVESDEAQEPSSSEAEVEEEREEEDSEPTQNP-ITVIQR---------- 303

  Fly   120 RSMTALADTEEGRQVMEDNRKYDELLS----GTDKTRRTVDA-DTQTMTALMKSRLVNTERL--- 176
                   |.::.|::  |:..||..|.    .:..|:...|: ||.:|        .|:|:|   
  Fly   304 -------DKDQERKL--DSGHYDMHLRRNPLSSLSTQNQYDSFDTNSM--------ANSEQLDSG 351

  Fly   177 --TT-----------AQMGSY---VSN-----------------------FEM----YD----TY 194
              ||           ...|.|   ||:                       |||    |:    :|
  Fly   352 ISTTGVEKPRSGEANVYYGGYSGFVSHPVISRRGEELMAKLRFDQLNYHLFEMKPLSYEGFMQSY 416

  Fly   195 TDLEKSTTSVQVQG------AKKMEITTY--------HVGGVDQFVGINC--------------L 231
            ..|..|..:.|.|.      .:.:|:.:.        |.||  ||| ::|              .
  Fly   417 GKLNASQVATQTQSPHMDGECQTLEVHSRSSWTQHPPHYGG--QFV-LSCSVDAELDETWSKQPA 478

  Fly   232 PGFRLALMLTMRILASNVFEPQQRRYRNMAPPDPLAEDVKFKYRLGLLWRL---------SPPSS 287
            ..:..::....::........||.:.:.:|....|.....|.:|.|.|..|         ...:|
  Fly   479 DEYEASISRLEQLHRLEQARSQQLQQKRLAKSTDLERLNSFLHRAGRLMGLVLEGKTTAHGQGNS 543

  Fly   288 DPKVHQAVSDMSFCP--------SNGDIMAVAYGVYSHGKVSKLPRSGWVYVWNIKNPVNPERRY 344
            ...|......::..|        .||.::...:...:...|.|...:..:.||::.||..|.|..
  Fly   544 PRNVPLQTGLLNALPVRRIFGSAGNGQLVVTVHECPADSNVYKEDFASLLMVWSLANPSQPLRLL 608

  Fly   345 HYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRDISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEG 409
            .....|..|..|.....::..||.:|.|.:.|:            |.:..|...:          
  Fly   609 STWAEVSRVALSAQAQDIVVAGLRDGSVAMWDL------------RETHSYCSKL---------- 651

  Fly   410 DVGCRNPHITPFLATSQAGAVTKY--RLINSPNMLGLEQQRLQRAEGELEGIPIERQPPAASLLA 472
                 :.|:|.|.||.....:.:.  :.:|:.::..:...|..|:.....|:       ||:   
  Fly   652 -----DGHLTHFAATQSVVPMPEQQDKEVNAMDLGAVVDVRSFRSHLNAGGV-------AAT--- 701

  Fly   473 NRHPQCLEIVLDPVQSDIYYVLTDEGTLY-------KCSTNYPLQHLELRQVHDGPAACMEF-SP 529
                ..|:.....||   |..|.|.|.|.       ..|||                 ..|| ||
  Fly   702 ----SGLQTTYKEVQ---YASLNDSGLLTMWTLVEGASSTN-----------------SNEFSSP 742

  Fly   530 WSPRMYLTCGSDWC-IRIWLAGILLPIVTLQHHLSPVHCARWSRTHS---------TILVSLSRS 584
            |:....|..||  | :|.:          |:..|...|.:.:.:|.|         .:|..|:.:
  Fly   743 WARVKLLQSGS--CDLRSY----------LERRLLKSHQSAYEKTKSLFQGNIYSDDVLRELNDT 795

  Fly   585 TVDIWDLRNSTMKPVSSTVID--ADIFY--TTFKFT-HCGRSL---------------------- 622
            ......|:...::.:..|.||  :::.|  |...|. .|.|||                      
  Fly   796 QTLTTALQGQGLQGLRFTSIDTGSELIYVCTNRNFVLCCTRSLKTERFARIAVNESRFLFPTSLC 860

  Fly   623 --------AVGNEAGNLLMLS 635
                    |||...|::::|:
  Fly   861 VLSNENYVAVGLSNGSVMILN 881

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 80/430 (19%)
WD40 repeat 295..344 CDD:293791 11/57 (19%)
WD40 repeat 350..397 CDD:293791 10/47 (21%)
WD40 repeat 400..473 CDD:293791 11/75 (15%)
WD40 repeat 478..513 CDD:293791 11/42 (26%)
WD40 <518..>593 CDD:295369 18/86 (21%)
WD40 repeat 524..560 CDD:293791 11/38 (29%)
CG15701NP_611100.1 PTZ00108 <23..270 CDD:240271 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.