DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and DNAI1

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001268357.1 Gene:DNAI1 HGNCID:2954 Length:703 Species:Homo sapiens

Alignment Length:587 Identity:124/588 (21%)
Similarity:233/588 (40%) Gaps:117/588 (20%)


  Fly   127 DTEEGRQV------MEDNRKYDELLSGTDKTRRTV-------DADTQTMTALMKSRLVNTERLTT 178
            :||.|.|.      ..:....:||::......|.:       :..:||....::.|...||....
Human   158 ETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPR 222

  Fly   179 AQMGSYVSNFEMYDTYT-DLEKSTTSVQVQGAKKMEITTYHVGGVDQFVGINCLPGFRLALMLTM 242
            ....:..:.:|:||.|. :|||...:.:.:.||                    .|..:.:..:.|
Human   223 TNFSATANQWEIYDAYVEELEKQEKTKEKEKAK--------------------TPVAKKSGKMAM 267

  Fly   243 RILASNVFEPQ-------------QRRYRNMAPPDPLAEDVKF------KYR--LGLLWRLSPPS 286
            |.|.|  .|.|             ..|..|....|.:|:|.|:      :||  :|.|..|....
Human   268 RKLTS--MESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQ 330

  Fly   287 SDPKVHQAVSDMSFCPSNGDIMAVAYGVYSHGKVSKLPRSGWVYVWNIKNPVNPERRYHYQVPVV 351
            :|.....:|:.:.:.|...|:.||.||.|...|.|:    |.:.::::|||..||..:.....|:
Human   331 NDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSR----GMLLLYSLKNPSFPEYMFSSNSGVM 391

  Fly   352 TVEFSPTQPQLLAIGLHNGGVEVRDISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEGDVGCRNP 416
            .::.....|.|:|:|.::|.|.:.::......|...|...|..:.:||..:||...:.|....  
Human   392 CLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLN-- 454

  Fly   417 HITPFLATSQAGAVTKYRLINSPNMLGLEQQRLQRAEGELEGIP--IERQPPAASLLANRHPQCL 479
                |.:.|..|.:..:.|:.. .::.::..:| :.||....:|  ::..|.......:.|.:. 
Human   455 ----FFSVSSDGRIVSWTLVKR-KLVHIDVIKL-KVEGSTTEVPEGLQLHPVGCGTAFDFHKEI- 512

  Fly   480 EIVLDPVQSDIYYVLTDEGTLYKCSTNYPLQHLELRQVHDGPAACMEFSPWSPRMYLTCGSDWCI 544
                    ..::.|.|:||.:||||.:|..|.|:....|:.....:.::|:..:::::|.|||.:
Human   513 --------DYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTV 569

  Fly   545 RIWLAGILLPIVTLQHHLSPVHCARWSRTHSTILVSLSRSTVD----IWDLRNSTMKPVSSTVID 605
            :||...|..|:.....: |.|....|:...||:..::   |.|    |:||..:..:.:.:..:.
Human   570 KIWDHTIKTPMFIYDLN-SAVGDVAWAPYSSTVFAAV---TTDGKAHIFDLAINKYEAICNQPVA 630

  Fly   606 AD---IFYTTFKFTHCGRSLAVGNEAGNLLMLSFEDMPFPPHFQYKQLKRAIFKALSMQPDLRKQ 667
            |.   :.:..|...|  ..:.||::.|:::                        :|.:.|:|||.
Human   631 AKKNRLTHVQFNLIH--PIIIVGDDRGHII------------------------SLKLSPNLRKM 669

  Fly   668 VK 669
            .|
Human   670 PK 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 81/378 (21%)
WD40 repeat 295..344 CDD:293791 16/49 (33%)
WD40 repeat 350..397 CDD:293791 10/47 (21%)
WD40 repeat 400..473 CDD:293791 12/75 (16%)
WD40 repeat 478..513 CDD:293791 11/35 (31%)
WD40 <518..>593 CDD:295369 20/79 (25%)
WD40 repeat 524..560 CDD:293791 9/36 (25%)
DNAI1NP_001268357.1 WD40 324..681 CDD:225201 86/400 (22%)
WD 1 324..374 13/54 (24%)
WD40 repeat 339..385 CDD:293791 16/50 (32%)
WD40 <357..615 CDD:295369 64/283 (23%)
WD 2 379..417 9/38 (24%)
WD40 repeat 391..428 CDD:293791 7/37 (19%)
WD 3 426..469 10/49 (20%)
WD40 repeat 439..496 CDD:293791 12/65 (18%)
WD 4 478..530 14/62 (23%)
WD40 repeat 504..541 CDD:293791 12/46 (26%)
WD 5 535..574 10/39 (26%)
WD40 repeat 547..584 CDD:293791 9/37 (24%)
WD 6 578..616 10/42 (24%)
WD40 repeat 589..616 CDD:293791 8/30 (27%)
WD 7 622..662 7/66 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D310818at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.