DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13930 and SdicC

Sequence 1:NP_647645.1 Gene:CG13930 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001303578.1 Gene:SdicC FlyBaseID:FBgn0283434 Length:544 Species:Drosophila melanogaster

Alignment Length:369 Identity:83/370 (22%)
Similarity:148/370 (40%) Gaps:75/370 (20%)


  Fly   313 GVYSHGKVSKLPRSGWVYVWNIK-NPVNPERRYHYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRD 376
            |.|.:.:.|.....|.|.|||.| ....||..:|.|..|::..|:...|.|:..|.::|.:.:.|
  Fly   211 GSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWD 275

  Fly   377 ISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEGDVGCRNPHITPFLATSQAGAVTKYRLINSPNM 441
            ...|...|:..:...::.:..||..::.      ||.:|.|  ..::.|..|.:..:.|    :|
  Fly   276 NRVQKRTPIQRTPLSAAAHTHPVYCLQM------VGTQNAH--NVISISSDGKLCSWSL----DM 328

  Fly   442 LGLEQQRLQRAEGELEGIPIERQPPAASLLANRHP--QCLEIVLDPVQSDIYYVLTDEGTLYKCS 504
            |...|..|     ||:    :||..|.::.:...|  :...:|:.          :::|.:|..|
  Fly   329 LSQPQDTL-----ELQ----QRQSKAIAITSMAFPANEINSLVMG----------SEDGYVYSAS 374

  Fly   505 TNYPLQH------LELRQVHDGPAACM-----EFSPWSPRMYLTCGSDWCIRIWLAGILLPIVTL 558
                 :|      .|:.:.|.||...:     :.||....::||..    |:||  .:.|||.:.
  Fly   375 -----RHGLRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSS----IKIW--SLKLPISSC 428

  Fly   559 QHHL-------SPVHC----------ARWSRTHSTILVSLSRS-TVDIWDLRNSTMKPVSSTVID 605
            |..:       .|::.          ..||..|..:..::..| .:|:|:|...|..|.:|.|:.
  Fly   429 QFSVVSGINSNKPLYSFEDNSDYMMDVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPTASIVVA 493

  Fly   606 ADIFYTTFKFTHCGRSLAVGNEAGNLLMLSF-EDMPFPPHFQYK 648
            .........:|..|..:.:|:|||.|.:... |::..|...:.|
  Fly   494 GAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDEIK 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13930NP_647645.1 WD40 <279..648 CDD:225201 82/368 (22%)
WD40 repeat 295..344 CDD:293791 11/32 (34%)
WD40 repeat 350..397 CDD:293791 9/47 (19%)
WD40 repeat 400..473 CDD:293791 16/73 (22%)
WD40 repeat 478..513 CDD:293791 5/41 (12%)
WD40 <518..>593 CDD:295369 22/98 (22%)
WD40 repeat 524..560 CDD:293791 11/41 (27%)
SdicCNP_001303578.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368
WD40 196..523 CDD:295369 80/354 (23%)
WD40 repeat 196..245 CDD:293791 12/34 (35%)
WD40 <224..534 CDD:225201 79/352 (22%)
WD40 repeat 251..289 CDD:293791 8/38 (21%)
WD40 repeat 298..337 CDD:293791 12/56 (21%)
WD40 repeat 349..386 CDD:293791 7/52 (13%)
WD40 repeat 393..446 CDD:293791 12/59 (20%)
WD40 repeat 452..491 CDD:293791 10/39 (26%)
WD40 repeat 498..522 CDD:293791 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60896511
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.