DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and rab36

DIOPT Version :8

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_004910645.1 Gene:rab36 / 733793 XenbaseID:XB-GENE-490801 Length:264 Species:Xenopus tropicalis

Alignment Length:178 Identity:90/179 (50%)
Similarity:125/179 (70%) Gaps:2/179 (1%)


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |.:.|||..||||:::||||.:.|..:||||||||||:|.|.|||..::.::|||||||:|:|||
 Frog    56 KAVMVGDLYVGKTSLINRFCKNVFDRDYKATIGVDFEIERFEILGIPFNFQIWDTAGQEKFKCIA 120

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLA 195
            .||||.|.||:..:|:....:||:.::|:..||..|......:||||||.|.||:.|..|.|:.|
 Frog   121 SAYYRGAQVIITAFDLGDISTLENTRRWVQDALKENEPDTCSIFLVGTKKDTLSEAELERTEQDA 185

  Fly   196 GLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNK 243
            ...|.:||||||||||::|..|.|.|.|:|:||||:::.:|:.  ||:
 Frog   186 VRLAIDLQAEYWSVSAKTGENVKEFFFRVASLAFEQSMKKELE--KNR 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 86/164 (52%)
RAB 66..225 CDD:197555 82/159 (52%)
rab36XP_004910645.1 P-loop_NTPase 55..220 CDD:304359 86/164 (52%)
Ras 56..215 CDD:278499 82/159 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256838588
eggNOG 1 0.900 E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3610
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1048146at2759
OrthoFinder 1 1.000 FOG0002322
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.