DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab6b

DIOPT Version :8

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017451234.1 Gene:Rab6b / 363123 RGDID:1309958 Length:233 Species:Rattus norvegicus

Alignment Length:215 Identity:75/216 (35%)
Similarity:116/216 (54%) Gaps:27/216 (13%)


  Fly    40 LSKERDFGAQVRYYLEAPRKPKFRPCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELE 104
            :|...|||..:|         ||   |::|:|:.|||||:::.||.||.|.:.|:||||:||..:
  Rat     1 MSAGGDFGNPLR---------KF---KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSK 53

  Fly   105 NFSILGHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASK 169
            ...:......|::||||||||||.:..:|.|:::|.||.||::..:|.:...||::.......|.
  Rat    54 TMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSD 118

  Fly   170 RPLVFLVGTKADLLSKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIA-ALAFEEAV 233
             .::.|||.|.||..|.:....|  ....|.||...:...||::|:.|.:||:|:| ||...|.|
  Rat   119 -VIIMLVGNKTDLADKRQITIEE--GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENV 180

  Fly   234 MQEIRSIKNKPQEQATQASV 253
                       ||::.:.|:
  Rat   181 -----------QEKSKEGSI 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 63/165 (38%)
RAB 66..225 CDD:197555 60/159 (38%)
Rab6bXP_017451234.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.