DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab35

DIOPT Version :8

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster

Alignment Length:214 Identity:67/215 (31%)
Similarity:101/215 (47%) Gaps:25/215 (12%)


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130
            |::.:||..|||::::.||..|.|..:|..||||||::....|.|....|::||||||||||.|.
  Fly    10 KLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRTIT 74

  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSAL-NYNASKRPLVFLVGTKADLLSKEEFVRMERL 194
            ..|||....::|.||::..:|..:.::||.... |.:..|:   .|||.|.|  ..:..|.:...
  Fly    75 STYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKK---VLVGNKND--DPDRKVVITED 134

  Fly   195 AGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASVKSQTFD 259
            |...|.::..|.:..||:....|..:|..|.....:       ..::..|.||      :..|..
  Fly   135 AQRFAKQMDIELFETSAKDNINVENMFLSITRQVLD-------HKLRTSPNEQ------QKDTLH 186

  Fly   260 LR-NFFGSRLSQQKSGCTC 277
            |: |..||     |.|..|
  Fly   187 LKPNPKGS-----KGGKCC 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 56/165 (34%)
RAB 66..225 CDD:197555 56/160 (35%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 67/215 (31%)
RAB 9..170 CDD:197555 56/165 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120961996
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24073
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.