DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and CG4789

DIOPT Version :8

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster

Alignment Length:236 Identity:46/237 (19%)
Similarity:83/237 (35%) Gaps:78/237 (33%)


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGH----------NYSLEMWDT 120
            :::.|||..||||::.:...:::.......|:|.     |..:..|          .|.:|::|.
  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGC-----NIQVKMHPFREGTARECPYFVELFDV 67

  Fly   121 AGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALN--------------------- 164
            .|....:.....:|.....|::.:|::...|......||...:|                     
  Fly    68 GGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSP 132

  Fly   165 ----------------------YNASKRPLVFLVGTKADLLSKEEFVRM--ERLAGLAAAELQAE 205
                                  ..|::.| :.::|||.|||.::...:|  ::..|:|......|
  Fly   133 LSSFSTDNLGTDGHILFDMEEFLGATQTP-ILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEE 196

  Fly   206 YW-----SVSARSG----FKVTELFQRI--------AALAF 229
            .|     |.|..:|    .|::..|.|:        |||||
  Fly   197 IWLNCRNSRSLAAGTTDAVKLSRFFDRVIENRKALRAALAF 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 46/237 (19%)
RAB 66..225 CDD:197555 41/231 (18%)
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 41/226 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120963476
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24073
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.