DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7974 and AT1G02330

Sequence 1:NP_001261273.1 Gene:CG7974 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_563649.1 Gene:AT1G02330 AraportID:AT1G02330 Length:279 Species:Arabidopsis thaliana

Alignment Length:315 Identity:96/316 (30%)
Similarity:147/316 (47%) Gaps:89/316 (28%)


  Fly    22 RKNLRQR------KNSD-------EEEKEEQLTLDEIKERQRLRQRPNGV----SLVGLALGKKI 69
            ::|.|:|      :::|       |||::.:|.|:|:|..|:||:|..|:    |....::| |:
plant     4 KRNFRKRSFEEEEEDNDVNKAAISEEEEKRRLALEEVKFLQKLRERKLGIPALSSTAQSSIG-KV 67

  Fly    70 AP---------EEELAIKDPFNVKTGGLVNMKQLKSGKMKEADDAYDVGIGTQFSAETNKRDEDE 125
            .|         :|||.::|.|..:|..|:                                 ||.
plant    68 KPVEKTETEGEKEELVLQDTFAQETAVLI---------------------------------EDP 99

  Fly   126 EMMKYIEQELQKRKGGGTEDAAEDDGDVNKYLTPEDAALYALPDHLRQSSSHRSEEMLSNQMLNG 190
            .|:|||||||.|::|...:||.|.:.::.:.   || .||.:||||:...  ||.|..|.|...|
plant   100 NMVKYIEQELAKKRGRNIDDAEEVENELKRV---ED-ELYKIPDHLKVKK--RSSEESSTQWTTG 158

  Fly   191 IPEVDLGIVAKIRNIEATEEAKQKLLQDAKNKKDGPSQF-VPTNMAVNFMQHNRFNIEDNSDQRR 254
            |.||.|.|..|::|||.||.|| ||||:.:......|:| :|::.:.::.|..:    |.:::.|
plant   159 IAEVQLPIEYKLKNIEETEAAK-KLLQERRLMGRPKSEFSIPSSYSADYFQRGK----DYAEKLR 218

  Fly   255 RKREE----REG--------NKSAQHQTNPN---GVKR--ATDDYHYDKFRKQFR 292
            |:..|    |.|        ..|....||.|   |..|  |||....::|||:.|
plant   219 REHPELYKDRGGPQADGEAAKPSTSSSTNNNADSGKSRQAATDQIMLERFRKRER 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 42/101 (42%)
AT1G02330NP_563649.1 Hep_59 87..181 CDD:311171 45/134 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9551
Inparanoid 1 1.050 96 1.000 Inparanoid score I2156
OMA 1 1.010
OrthoDB 1 1.010 D1493869at2759
OrthoInspector 1 1.000 T192865
orthoMCL 1 0.900 OOG5_130698
Panther 1 1.100 LDO PTHR13486
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.