DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7974 and c9orf78

Sequence 1:NP_001261273.1 Gene:CG7974 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001165770.1 Gene:c9orf78 XenbaseID:XB-GENE-5877135 Length:290 Species:Xenopus tropicalis

Alignment Length:298 Identity:145/299 (48%)
Similarity:198/299 (66%) Gaps:34/299 (11%)


  Fly    21 GRKNLRQRK--NSDEEEKEEQLT------LDEIKERQRLRQRPNGVSLVGLALGKKIAPEEELAI 77
            |.:|.|:||  :||||.:.|::|      |:|.||.|.||:|.||||...|.:|::: |||.:..
 Frog     3 GGRNFRRRKASSSDEEAEAEEVTQEVRIKLEEAKEVQSLRKRQNGVSAAALLVGERL-PEEVIMA 66

  Fly    78 KDPFNVKTGGLVNMKQLKSGKMKEADDAYDVGIGTQFSAETNKRDEDEEMMKYIEQELQKRKGGG 142
            .|||.:::||:|:||:||........:..|:.:||.||||||:||||.:||||||.||:||||  
 Frog    67 DDPFKMQSGGMVDMKKLKDRGKDRLGEEEDLNLGTSFSAETNRRDEDADMMKYIETELKKRKG-- 129

  Fly   143 TEDAAEDDGDVNKYLTPEDA--ALYALPDHLRQSSSHRSEEMLSNQMLNGIPEVDLGIVAKIRNI 205
               ..|::   .|.:.|:.|  .||.||:.::.||:.::|||||||||:|||||||||.|||:||
 Frog   130 ---IVENE---EKKVKPKSAEDCLYELPESIKVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNI 188

  Fly   206 EATEEAKQKLLQDAKN-KKDGPSQFVPTNMAVNFMQHNRFNIED-NSDQRRRKREER-------- 260
            .:|||||.:||.:.:| |||..:.|||||||||::|||||..|| |:..||.|.|.:        
 Frog   189 ISTEEAKARLLAEQQNKKKDKHTSFVPTNMAVNYVQHNRFYQEDQNTPMRRHKEEPKPRPLRVGD 253

  Fly   261 ----EGNKSAQHQTNPNGVKRATDDYHYDKFRKQFRRY 294
                |..||..::..|:. ::|||||||:||:|..|||
 Frog   254 TEKPEPEKSPPNRKRPSN-EKATDDYHYEKFKKMNRRY 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 60/103 (58%)
c9orf78NP_001165770.1 Hep_59 102..197 CDD:284467 60/103 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152736950
eggNOG 1 0.900 E1_KOG3345
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9551
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1493869at2759
OrthoFinder 1 1.000 FOG0005973
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.