DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7974 and SPAC1D4.01

Sequence 1:NP_001261273.1 Gene:CG7974 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001342820.1 Gene:SPAC1D4.01 PomBaseID:SPAC1D4.01 Length:254 Species:Schizosaccharomyces pombe

Alignment Length:289 Identity:55/290 (19%)
Similarity:119/290 (41%) Gaps:59/290 (20%)


  Fly    18 KKAGRKNLRQRK--NSDEEEKEEQLTLDEIKERQRL---RQRPNGVSLVGL----ALGKKIAPEE 73
            ||...::.|:||  .:::|...|:|..::|:.||.|   ::|....|::|:    .|.::...|:
pombe     7 KKKSNRSFRRRKVFGNEKEFDLEELDDNDIRLRQALEATKRRKIRNSIIGINAEKLLNQETKKEK 71

  Fly    74 EL-AIKDPFNVKTGGLVNMKQLKSGKMKEADDAYDVGIGTQFSAETNKRDEDEEMMKYIEQELQK 137
            :| ...:|............:|...::...:|        :|:.:||:.|.:..::.::|::|::
pombe    72 QLNTANEPHEANDQTSAQSSKLIEAQLPTVED--------RFAKQTNEVDINTHLLNFVEKKLKQ 128

  Fly   138 RKGGGTEDAAEDDGDVNKYLTPEDAALYALPDHLRQSSSHRSEEMLSNQ--MLNGIPEVDLGIVA 200
            .:   ......::|:.|...|..::.:..:     ::|.|.:|......  .|..|.||||||::
pombe   129 ER---LAQNYSENGETNALNTKNESTVQNI-----KNSLHPNEHSFIRDAAALGAIREVDLGIIS 185

  Fly   201 KIRNIEATEEAKQKLLQDAKNKKDGPSQFVPTNMAVNFMQHNRFNIEDNSDQRRRKREEREGNKS 265
                            .|..|.|:|..:           |..|..:::..|.:..:..|    .:
pombe   186 ----------------TDVDNLKNGRKR-----------QKKRARMKEKLDSKALRTSE----DA 219

  Fly   266 AQHQTNPNGVKRATDDYHYDKFRKQFRRY 294
            |:.:.....:|..:.|.......::||.|
pombe   220 ARDEFIEKMLKPISQDEESKGIYRRFRVY 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 20/103 (19%)
SPAC1D4.01NP_001342820.1 Hep_59 104..183 CDD:311171 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130698
Panther 1 1.100 LDO PTHR13486
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.