DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7974 and C9orf78

Sequence 1:NP_001261273.1 Gene:CG7974 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_057604.1 Gene:C9orf78 HGNCID:24932 Length:289 Species:Homo sapiens

Alignment Length:293 Identity:147/294 (50%)
Similarity:197/294 (67%) Gaps:28/294 (10%)


  Fly    22 RKNLRQRKNSDEEEKEEQ------LTLDEIKERQRLRQRPNGVSLVGLALGKKIAPEEELAIKDP 80
            ||..|:|:...|.|::||      |.|:|.:|.|.||:||||||.|.|.:|:|: .||...:.||
Human     5 RKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKV-QEETTLVDDP 68

  Fly    81 FNVKTGGLVNMKQLKS-GKMKEADDAYDVGIGTQFSAETNKRDEDEEMMKYIEQELQKRKGGGTE 144
            |.:||||:|:||:||. ||.|.:::. |:.:||.||||||:||||.:||||||.||:||||    
Human    69 FQMKTGGMVDMKKLKERGKDKISEEE-DLHLGTSFSAETNRRDEDADMMKYIETELKKRKG---- 128

  Fly   145 DAAEDDGDVNKYLTPEDAALYALPDHLRQSSSHRSEEMLSNQMLNGIPEVDLGIVAKIRNIEATE 209
             ..|.:....|....|| .||.||:::|.||:.::|||||||||:|||||||||.|||:||.:||
Human   129 -IVEHEEQKVKPKNAED-CLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTE 191

  Fly   210 EAKQKLLQDAKN-KKDGPSQFVPTNMAVNFMQHNRFNIED-NSDQRRRKREER-------EGNKS 265
            :||.:||.:.:| |||..:.|||||||||::|||||..|: |:..||.|.|.:       :..|.
Human   192 DAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNRFYHEELNAPIRRNKEEPKARPLRVGDTEKP 256

  Fly   266 AQHQTNPN----GVKRATDDYHYDKFRKQFRRY 294
            ...::.||    ..::|||||||:||:|..|||
Human   257 EPERSPPNRKRPANEKATDDYHYEKFKKMNRRY 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 60/101 (59%)
C9orf78NP_057604.1 Hep_59 101..196 CDD:311171 60/101 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152735913
eggNOG 1 0.900 E1_KOG3345
Hieranoid 1 1.000
Homologene 1 1.000 H9551
Inparanoid 1 1.050 247 1.000 Inparanoid score I3224
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1493869at2759
OrthoFinder 1 1.000 FOG0005973
OrthoInspector 1 1.000 T1075261
orthoMCL 1 0.900 OOG5_130698
Panther 1 1.100 LDO PTHR13486
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4416
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.