DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7974 and zgc:103692

DIOPT Version :8

Sequence 1:NP_001261273.1 Gene:CG7974 / 38207 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001005945.1 Gene:zgc:103692 / 449772 ZFINID:ZDB-GENE-041010-15 Length:289 Species:Danio rerio

Alignment Length:292 Identity:151/293 (52%)
Similarity:194/293 (66%) Gaps:27/293 (9%)


  Fly    23 KNLRQRK--NSDEEEKEEQLT----LDEIKERQRLRQRPNGVSLVGLALGKKIAPEEELAIKDPF 81
            ||.|:||  :||||:.|.:..    |||.||.|.||:|.:|||:..|.:|:|:..|.||. .|||
Zfish     5 KNFRRRKEDSSDEEDDETKFVVRSKLDEAKELQSLRKRQHGVSIATLLVGEKLPLEAELE-DDPF 68

  Fly    82 NVKTGGLVNMKQLKSGKMKEADDAYDVGIGTQFSAETNKRDEDEEMMKYIEQELQKRKGGGTEDA 146
            .:||||:|:||::|........|..|:.:||.||||||:||||.:||||||.||:|:||     .
Zfish    69 KLKTGGVVDMKKVKDRSRDMTVDENDLNLGTSFSAETNRRDEDADMMKYIETELKKKKG-----M 128

  Fly   147 AEDDGDVNKYLTPEDAALYALPDHLRQSSSHRSEEMLSNQMLNGIPEVDLGIVAKIRNIEATEEA 211
            .|.:....|...||| .||.||:::..||:.::|||||||||:|||||||||.|||:||..||||
Zfish   129 VEAEEQKVKVKNPED-LLYELPENINVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIINTEEA 192

  Fly   212 KQKLLQDAKN-KKDGPSQFVPTNMAVNFMQHNRFNIEDNSDQRRRKREE------REGN--KSAQ 267
            |.|||.:.:| |||..:.|||||:|||::|||||..||::..:||.|||      |.|:  |.|.
Zfish   193 KAKLLAEQRNKKKDSGTSFVPTNIAVNYVQHNRFYHEDSNAPQRRNREEPKARPLRVGDTEKPAP 257

  Fly   268 HQTNPNGVKR-----ATDDYHYDKFRKQFRRY 294
            ..:.||..||     |||||||:||:|..|||
Zfish   258 EASPPNFRKRPNNEKATDDYHYEKFKKMNRRY 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 60/101 (59%)
zgc:103692NP_001005945.1 Hep_59 100..195 CDD:284467 60/101 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152736378
eggNOG 1 0.900 E1_KOG3345
Hieranoid 1 1.000
Homologene 1 1.000 H9551
Inparanoid 1 1.050 248 1.000 Inparanoid score I3163
OMA 1 1.010
OrthoDB 1 1.010 D1493869at2759
OrthoFinder 1 1.000 FOG0005973
OrthoInspector 1 1.000 T1054513
orthoMCL 1 0.900 OOG5_130698
Panther 1 1.100 LDO PTHR13486
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4416
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.