DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7974 and RGD1305178

Sequence 1:NP_001261273.1 Gene:CG7974 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_006233977.1 Gene:RGD1305178 RGDID:1305178 Length:289 Species:Rattus norvegicus

Alignment Length:292 Identity:144/293 (49%)
Similarity:194/293 (66%) Gaps:28/293 (10%)


  Fly    23 KNLRQRKNSDEEEKEEQ------LTLDEIKERQRLRQRPNGVSLVGLALGKKIAPEEELAIKDPF 81
            |..|:|:...|.|::||      |.|:|.:|.|.||:||||||...|.:|:|: .||...:.|||
  Rat     6 KTFRRRRADSESEEDEQESEEVRLKLEETREVQNLRKRPNGVSAAALLVGEKV-QEETTLVDDPF 69

  Fly    82 NVKTGGLVNMKQLKS-GKMKEADDAYDVGIGTQFSAETNKRDEDEEMMKYIEQELQKRKGGGTED 145
            .:.|||:|:||:||. ||.|.:::. |:.:||.||||||:||||.:||||||.||:||||     
  Rat    70 QMATGGMVDMKKLKERGKDKVSEEE-DLHLGTSFSAETNRRDEDADMMKYIETELKKRKG----- 128

  Fly   146 AAEDDGDVNKYLTPEDAALYALPDHLRQSSSHRSEEMLSNQMLNGIPEVDLGIVAKIRNIEATEE 210
            ..|.:....|....|| .||.||:::|.||:.::|||||||||:|||||||||.|||:||.:||:
  Rat   129 IVEQEEQKAKPKNAED-CLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTED 192

  Fly   211 AKQKLLQDAKN-KKDGPSQFVPTNMAVNFMQHNRFNIED-NSDQRRRKREER-------EGNKSA 266
            ||.:||.:.:| |||..:.|||||||||::|||||..|: |:..||.|.|.:       :..|..
  Rat   193 AKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNRFYHEELNAPIRRNKEEPKARPLRVGDTEKPE 257

  Fly   267 QHQTNPN----GVKRATDDYHYDKFRKQFRRY 294
            ..::.||    ..::|||||||:||:|..|||
  Rat   258 PERSPPNRKRPANEKATDDYHYEKFKKMNRRY 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 60/101 (59%)
RGD1305178XP_006233977.1 Hep_59 101..196 CDD:311171 60/101 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152738021
eggNOG 1 0.900 E1_KOG3345
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3851
OMA 1 1.010
OrthoDB 1 1.010 D1493869at2759
OrthoFinder 1 1.000 FOG0005973
OrthoInspector 1 1.000 T1088915
orthoMCL 1 0.900 OOG5_130698
Panther 1 1.100 LDO PTHR13486
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.