DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7974 and M151.4

Sequence 1:NP_001261273.1 Gene:CG7974 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_494598.2 Gene:M151.4 WormBaseID:WBGene00019796 Length:571 Species:Caenorhabditis elegans

Alignment Length:334 Identity:67/335 (20%)
Similarity:124/335 (37%) Gaps:115/335 (34%)


  Fly     7 TKAEATTKVLFKKAGRKNLRQRKNSDEEEKEEQLTLDEIKERQRLRQRPNGVSLVGLALGKKIAP 71
            |:|...|..|.||..::.....|..::|.|:|   ::::|......:|.:....|.|   ||:..
 Worm   263 TEAAHATDQLRKKLQKQQDEHEKRVEQEHKKE---IEDLKGALAAEKRISEADKVEL---KKLTE 321

  Fly    72 E-EELAIKD--------PFNVKTGGLVN------------MKQLKSGKMK---EADDAYDVGIGT 112
            | :.:.:|:        ..|.:..|.|.            :|:|: ||.|   |.::|:.:.: .
 Worm   322 ELQSMHLKNKELKNNVTTENSRATGAVQEAQVLQEKLQQALKELE-GKKKELLEQENAHKLRM-D 384

  Fly   113 QFSAETNKRDEDEEMMKYIEQELQKRKGGGTEDAAEDDGDVNKYLTPEDAALYALPDHLRQSSSH 177
            ||..:|.||.:.|  :|.:|.|::||..                         .:.:|...:...
 Worm   385 QFEDDTKKRHKKE--IKALEVEVKKRNA-------------------------TIKEHQVAAQER 422

  Fly   178 RSEEMLSNQMLNGIPEVDLGIVAKIRNIE---ATEEAK-QKLLQDAKNKKDGPSQFVPTNMAVN- 237
            |::.                 .|::..:|   ||||.| ::::||.:.|.|  :||.|.:.:.: 
 Worm   423 RAKH-----------------DAEVEELEQKLATEEEKCRRIVQDIREKLD--AQFPPISRSPST 468

  Fly   238 ------------FMQHN-----------RFNIEDNSDQRRRKREEREGNKSAQHQ---------T 270
                        |.|..           .|:...:|.|....:||...::|...:         :
 Worm   469 ECVWPEMIIDDVFWQQPSSSTSHVYSSFAFSTPRSSSQNAPVQEEATSHQSTSSEPASSAPNSNS 533

  Fly   271 NPNGVKRAT 279
            :||...|.|
 Worm   534 SPNSSARIT 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 20/105 (19%)
M151.4NP_494598.2 Smc <45..>258 CDD:224117
Smc 160..>454 CDD:224117 50/243 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.