DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srrm234 and cwf21

DIOPT Version :10

Sequence 1:NP_001097475.2 Gene:Srrm234 / 38206 FlyBaseID:FBgn0035253 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_593820.1 Gene:cwf21 / 2543616 PomBaseID:SPAC4A8.09C Length:293 Species:Schizosaccharomyces pombe


Alignment Length:183 Identity:49/183 - (26%)
Similarity:75/183 - (40%) Gaps:45/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YNGIGLTTPRGSGTNGHVQRNWACVRPGKKDKDYRAEDDTKKLDAQLNRPPNKEILDHDRKRKIE 66
            ||||||.|||||||||:|.||.:.|:...|:.:.::..:.|.|:.::..|   .|.:|:.:|:||
pombe     3 YNGIGLPTPRGSGTNGYVMRNLSHVKKYDKNTNLQSNRNAKALEKRVQDP---SISEHECRRQIE 64

  Fly    67 VK-CLELEDILEKQGRTPEEIKSQVDSFRQKLMGQGKTDLAKDEFGRVANTTTSTATAAVRTTAT 130
            .| .|..|.:|       ||:.|           |..||.|..:......|.......|:.....
pombe    65 SKLLLYREQLL-------EEVSS-----------QHSTDAAASDSNTNFGTENPKPPKAIIKDEQ 111

  Fly   131 ASAATASTMTTTTEATTVK-----------------------VAKPKKRRKRR 160
            :.:.|.|......|....|                       :.:|:||::.|
pombe   112 SQSKTKSLDEADVEILVQKYREQLLKELQLQKSTEKGKNFESILQPQKRKETR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srrm234NP_001097475.2 cwf21_SRRM2-like 52..100 CDD:410600 12/48 (25%)
PTZ00121 <560..1154 CDD:173412
U2AF_lg 747..>876 CDD:273727
SRRM_C <1584..1612 CDD:464573
cwf21NP_593820.1 cwf21_CWC21-like 51..139 CDD:410599 23/108 (21%)
U2AF_lg 168..>277 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.