DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7971 and SRRM2

DIOPT Version :8

Sequence 1:NP_001097475.2 Gene:CG7971 / 38206 FlyBaseID:FBgn0035253 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_057417.3 Gene:SRRM2 / 23524 HGNCID:16639 Length:2752 Species:Homo sapiens

Alignment Length:2076 Identity:479/2077 (23%)
Similarity:703/2077 (34%) Gaps:766/2077 (37%)


  Fly     1 MYNGIGLTTPRGSGTNGHVQRNWACVRPGKKDK-DYRAEDDTKKLDAQLNRPPNKEILDHDRKRK 64
            |||||||.|||||||||:||||.:.||..:.:: ||:.|::.::|:|.|.:.||.:||||:|||:
Human     1 MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRR 65

  Fly    65 IEVKCLELEDILEKQGRTPEEIKSQVDSFRQKLMGQGKTDLAKDEFGRVANTTTSTATAAVRTTA 129
            :|::|||||:::|:||...::|:.:|.:||..|       |.||                     
Human    66 VELRCLELEEMMEEQGYEEQQIQEKVATFRLML-------LEKD--------------------- 102

  Fly   130 TASAATASTMTTTTEATTVKVAKPKKRRKRRKRAGHAITTTTTEKSAAISTPGSKTSSPRTQTGE 194
                                                             ..||.|..:|      
Human   103 -------------------------------------------------VNPGGKEETP------ 112

  Fly   195 PASSAPSATSNGARKTKAPYFQHDNREYLAKYESFRLTAHTWNYAAVARKFKPLRPALASGANKT 259
                                                                            .
Human   113 ----------------------------------------------------------------G 113

  Fly   260 RRPAVSKRTHPDCACACQQKDPEPALEPAHRTAEHSIQKELPSSQMKINIDGSVLLELLKYSSSS 324
            :||||:                                                           
Human   114 QRPAVT----------------------------------------------------------- 119

  Fly   325 LLGTLLGAGSAVATSARDTHQIAEAQQQKNARLREAFNISEYFVEGSSFDGDRKAKEDLAKSVAL 389
                             :|||:||..::||.|||.||.||:.:|:|||||..|:|:|  ||..| 
Human   120 -----------------ETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRARE--AKQPA- 164

  Fly   390 QKELDAQRESLAAAAAAAAAGKDKETGKRYALVRTPSRERDRDAGDAAANGDERDHVSKTDKKKR 454
                                   .|..|.|:|||..|..|                 |.|.|:|:
Human   165 -----------------------PEPPKPYSLVRESSSSR-----------------SPTPKQKK 189

  Fly   455 KKR-----ARESSASP--ERKKKKKSKKHKKESKSKKKRSR-------------KRKHSES---- 495
            ||:     .|..|:||  ||||..|.|||:.||:|||::.|             |||.|.|    
Human   190 KKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPA 254

  Fly   496 ------GRDSDRDSDEEDDSSEEERRES------------------------------------- 517
                  .|.:..||....|:|....|.:                                     
Human   255 PKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQ 319

  Fly   518 -----KNVRKKAKKDKKKRDKKLKKKSRARASSS------------------------------- 546
                 :...|:.....:.:||..|:||..|.|.|                               
Human   320 RPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATT 384

  Fly   547 --DSERTNSPSRKENKSDRSRGAKASKSDEKAPQQENVMRSRSRERKDTRSSRPLEASIDSRQRK 609
              ..|..|.||......|||    ..||.||.||..: ..|.....:.|:.||...:|.:|.:..
Human   385 PLSQEPVNPPSEASPTRDRS----PPKSPEKLPQSSS-SESSPPSPQPTKVSRHASSSPESPKPA 444

  Fly   610 P---RERSAATPPRKEPERHRERSKDRQRSKEKHRSRDRLRS---RERQRSRER---QRSRERQR 665
            |   ..|..::.|..:...|....:|:..|....|...|.||   .:|.|||.|   :|...|.|
Human   445 PAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSR 509

  Fly   666 SKERQRSKERQRSIERQRSKERQ-RSKERQR---SRSKDALRCKEKPQCNEKERSRERRRSKSKD 726
            |.:.:||:..|| ..|.||.:|: ||:..||   |||::..|         :.|||..||.:|..
Human   510 SPQWRRSRSAQR-WGRSRSPQRRGRSRSPQRPGWSRSRNTQR---------RGRSRSARRGRSHS 564

  Fly   727 RQ-----RSKEK---HRPKDEQQSVDKRRDRSTDRSKENQRSNE-----RQRSKERQRSKERERS 778
            |.     ||:.:   .|.:...::..:||.||...::...||..     |.||:...|.:.|.||
Human   565 RSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRS 629

  Fly   779 KDRQRSRERRRSKEGQLSKDRQGLKE-RQRSN---ERKRSKERQPSKEKQRSRE-------RQRS 832
            ..|:|||.|..::....|:.|...:. |.||.   .|.||:.|.|::...|||.       |.||
Human   630 PVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRS 694

  Fly   833 REPLQSKDRQRSKERQ-RSRERPAKEARPTRSPRERSSKSRDDRRHRSPTNASRKQKDDTKLSRN 896
            |.|.:.:.|.||..|: ||..|..:....:.|..||.:|||..:| ||.:|:|.:.|.....||.
Human   695 RTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQR-RSRSNSSPEMKKSRISSRR 758

  Fly   897 A------------------------------------RFKSPAHSPEA---------------PP 910
            :                                    |.:|.:..|:|               ||
Human   759 SRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSPPP 823

  Fly   911 KKSVPTP------AFNPFKAAEDTVNDILGTKSVMVALEQ--TKRQRAASSSSSD--------SD 959
            |:...||      :.:|....:.......|:.:...|.||  |.::|:...||.|        |.
Human   824 KQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSR 888

  Fly   960 SSGSSSTSSRTPSPKPTPRKQKKRSKTPELKEVKKEISPRKESRVSVKREQSNSPQKSKSKSKVD 1024
            .|.|.|:..|..|..| ||:...||.:|:.| ||..|||         |::|:|...|.|.|:| 
Human   889 HSCSGSSPPRVKSSTP-PRQSPSRSSSPQPK-VKAIISP---------RQRSHSGSSSPSPSRV- 941

  Fly  1025 ESSPKRTSRRSRSISS----ELRYSPAERH-----PERYHDIVQDKKRP-SKVREAHSTKPAPVV 1079
              :.:.|.|||||:|.    |.|..|...|     |:       .|.:| :..|::||...:|..
Human   942 --TSRTTPRRSRSVSPCSNVESRLLPRYSHSGSSSPD-------TKVKPETPPRQSHSGSISPYP 997

  Fly  1080 RLRAQSDDG---------------------------------------SDAETGVDGAALEEFQQ 1105
            :::||:..|                                       .::..||....|:...|
Human   998 KVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVKSSTPPGESYFGVSSLQLKGQSQ 1062

  Fly  1106 S-------------RREREEQQELRMLEQL--KSGIAAKAKQKIKIMEKDPAKEG-SEVSGSDQV 1154
            :             |:...|...|:...|.  |.|.:..:....::..:.|.::. .|.|.|..:
Human  1063 TSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGEFSASPML 1127

  Fly  1155 TATKRNSLSEF---------LVANNVTALINTLTTTTVTLTTTPPPPLAVVVPLEQR-------- 1202
            .:......|.|         :.:|::.......|..:......||...|...|..|:        
Human  1128 KSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPV 1192

  Fly  1203 QEQPQQ--------RDPDRELSVPVEDTVKKRDTSTPPICKTPQVTANGDAKSPTLVHKNHVHHN 1259
            |::|:.        |.|.||.|........|...|..|       |::.|.:...:|.|:    .
Human  1193 QDRPESSLVFKDTLRTPPRERSGAGSSPETKEQNSALP-------TSSQDEELMEVVEKS----E 1246

  Fly  1260 RPPPQHMHHHSQQ-----QQHHQHPP--GKRIFHNRTLNNNPN--SRHSTNNPHACGGGGVPH-- 1313
            .|..|.:.|.|.:     ..:.:..|  .:|...:.||:.:.:  |..:...|......|.||  
Human  1247 EPAGQILSHLSSELKEMSTSNFESSPEVEERPAVSLTLDQSQSQASLEAVEVPSMASSWGGPHFS 1311

  Fly  1314 ------SNS----NS-------SNSG--GNNNNAAML---------PFL---------------- 1334
                  |||    ||       .|||  |...|....         |||                
Human  1312 PEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMKEQST 1376

  Fly  1335 --AG------TPGTYNR---TTNRLNHGPLLTATHYNICKNHQHSLQQQQAHHLARGLVYNSALF 1388
              :|      :|....:   ::|:....|:|.|......:....|....:   :..||       
Human  1377 RSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPE---MKDGL------- 1431

  Fly  1389 GHGQRHPGLLSLTGAGVGM-SGPGAPLLGHPSHVRGGGGPISFNAAAAAAAVAANSISYLHHHHQ 1452
               .|.|...|.:|:..|: .|.|.|    ..|...|..|...:.....:...:...|       
Human  1432 ---PRTPSRRSRSGSSPGLRDGSGTP----SRHSLSGSSPGMKDIPRTPSRGRSECDS------- 1482

  Fly  1453 HQQKPKIVIKPFKIHDPQPLVAALADSSLV-----DAIVSKVSTATVAAAESAARRSRS------ 1506
             ..:||.:.:..:.....|....|.:..|.     ....|.|...|||.. ...:||||      
Human  1483 -SPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSESSVDQKTVART-PLGQRSRSGSSQEL 1545

  Fly  1507 --------RERR-------SRSKRRTSTSHHRHDSSS---ESRSRYSSSSSRSGSH--------- 1544
                    :||.       |::|.||.........||   :|:||.|...|||||.         
Human  1546 DVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRA 1610

  Fly  1545 --SSRSGSHSS------------RTSCSTNSSSGSSSSGSGSGSSQSGSRSPSIPR--RRGSPSF 1593
              .::|||.||            |.|.|.:||.|...|..||.|::|....|...|  ||||.|.
Human  1611 APRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSS 1675

  Fly  1594 LDRRRITSARKRPIPYHHKANAEGEVEDASSCCSSCFSRASSPATPLLTPLRNSRSPSMAA 1654
            .:.:    .:.|..|....:.:..|:...:.......|.:|||.|...||.|:.||||:::
Human  1676 PEPK----TKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSS 1732

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7971NP_001097475.2 cwf21 58..98 CDD:285507 19/40 (48%)
MIP-T3 672..>936 CDD:287245 93/350 (27%)
SRRM_C <1584..1610 CDD:291883 8/28 (29%)
SRRM2NP_057417.3 Sufficient for RNA-binding 197..259 23/62 (37%)
PHA03307 293..>600 CDD:223039 77/322 (24%)
PRK14971 <313..>411 CDD:237874 19/102 (19%)
PRK07003 <2195..>2452 CDD:235906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I2609
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004108
OrthoInspector 1 1.000 T1072309
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R267
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.