DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vta1 and FKS1

DIOPT Version :9

Sequence 1:NP_647640.1 Gene:Vta1 / 38204 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_013446.1 Gene:FKS1 / 851055 SGDID:S000004334 Length:1876 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:53/285 - (18%)
Similarity:87/285 - (30%) Gaps:105/285 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TRDVVIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKKQYAENEAITNEVAAQAHIENY 89
            |.|:.|.|..::...||                    |...:...|.|:      :.|..|::. 
Yeast   737 TTDMEIKYKPKVLISQV--------------------WNAIIISMYREH------LLAIDHVQK- 774

  Fly    90 ALKLFLYADKQDREENFGKNVVKA--FYSSGVLYDILQTFGELSEEALHNRKYAKWKAAYIHNCL 152
                .||  .|...|..||..::|  |:.|       |.......|.......|:.:.::....|
Yeast   775 ----LLY--HQVPSEIEGKRTLRAPTFFVS-------QDDNNFETEFFPRDSEAERRISFFAQSL 826

  Fly   153 KNGETPIPGPLPDDDDEAELEGENANASADTSPEDAAGAAAPAPYQPEPDSQPPAPSSPTTSGVV 217
               .||||.|||.|                                          :.||.:.:.
Yeast   827 ---STPIPEPLPVD------------------------------------------NMPTFTVLT 846

  Fly   218 PPTAEEVLNNPNKLPSPPVDEEKPGGFVPYVPTAQPNPATAATIYQPIVPVAGVQITPDQMITAQ 282
            |..||.:|.:..::    :.|:.           |.:..|.....:.:.||.......|..|.|:
Yeast   847 PHYAERILLSLREI----IREDD-----------QFSRVTLLEYLKQLHPVEWECFVKDTKILAE 896

  Fly   283 KYCKYAGS---ALNYDDVKTAIENL 304
            :...|.|:   |...|.:|:.|::|
Yeast   897 ETAAYEGNENEAEKEDALKSQIDDL 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:398366 23/124 (19%)
Vta1_C 275..311 CDD:407932 10/33 (30%)
FKS1NP_013446.1 RCR <18..80 CDD:403477
FKS1_dom1 300..409 CDD:405046
Glucan_synthase 808..1631 CDD:396784 31/174 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.