DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and VTA1

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_013282.1 Gene:VTA1 SGDID:S000004171 Length:330 Species:Saccharomyces cerevisiae

Alignment Length:324 Identity:78/325 (24%)
Similarity:134/325 (41%) Gaps:55/325 (17%)


  Fly    29 VIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKKQY-AENEA-------------ITNE 79
            :|.|:.:|||:::.|....::.|.|.|...::|.:|..||:. .|:||             |.::
Yeast    22 IIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQ 86

  Fly    80 VAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYS-----SGVLYDILQTFGELSEEALHNR- 138
            ..|:.::.|:.:.|:....||.::..:...:.::.:.     |.:|:...:...|.|..:|..| 
Yeast    87 EKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRI 151

  Fly   139 KYAKWKAAYIHNCLKNGE-------TPIPGPLPDDDDE----------AELEGENANASADTSPE 186
            ||.|   .|:.. |..||       |.......||.:|          ::||..|.:.....:|:
Yeast   152 KYCK---IYLSK-LAKGEIGSSDEKTLDYADFADDSEEIKDEDVDHQTSDLENNNNDKVEGLAPK 212

  Fly   187 DAAGAAAPAPYQPE--PDSQPPAPSSPTTSGVVPPTAEEVLNNPNKLPSPPVDEEKPGGFVPYVP 249
            |...:..|....||  .|    |.|.......|....:.:..:..::....||..:|.  .|..|
Yeast   213 DQTTSYEPVDEVPEFIDD----ADSVNEEEQTVDKNEDAITKDEQQVVKKEVDLTRPS--APSEP 271

  Fly   250 TAQPNPATAATIYQPIVPVAGVQITPDQMITAQKYCKYAGSALNYDDVKTAIENLQKALKLLST 313
            .|..:.:........|:..|      .::...||..|||.|||||:|:.||.:.|.|||.||::
Yeast   272 AAAEHKSYTKDELTKIMDRA------SKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNS 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 32/139 (23%)
VTA1NP_013282.1 Vta1 10..161 CDD:309683 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I1766
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004767
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46009
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1664
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.