DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and EXT-like

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_194405.1 Gene:EXT-like AraportID:AT4G26750 Length:421 Species:Arabidopsis thaliana

Alignment Length:422 Identity:109/423 (26%)
Similarity:174/423 (41%) Gaps:120/423 (28%)


  Fly     5 PCPPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLK--ASTQTGEETKLLLGIMDWLEQMK 67
            |..|: :::..:|:.|.|....:.::||:.||||::.|||  .|.:|.....:|:.:::.||:.|
plant     4 PNEPA-RALLPYLQRADELQKHEPLVAYYCRLYAMERGLKIPQSERTKTTNSILMSLINQLEKDK 67

  Fly    68 KQYAENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSE 132
            |      ::|.......|:|.:||.:|..||||||.........|.||::.:.::||..||.:..
plant    68 K------SLTLSPDDNMHVEGFALSVFAKADKQDRAGRADLGTAKTFYAASIFFEILSQFGPVPP 126

  Fly   133 EALHNRKYAKWKAAYIHNCLKNGETPIPGPLPDDDDEAEL-----EGENANASADT--------- 183
            :.....|||.||||.|...:|.|..|.||...|||.:..:     .|...::::||         
plant   127 DIEQKHKYAAWKAADIRKAIKEGRKPTPGDPVDDDTDLSIPSSGPSGSYDHSASDTNTTSHHRTE 191

  Fly   184 ------SPEDAAGAAAP-APYQPEP-------------DSQPPAPSS-PTTSGVVPPT------- 220
                  |.:|::....| .|..|.|             |..||.||| |:...:.|||       
plant   192 LDPPHDSNDDSSHHQFPEVPQHPLPPRFYDNPTNDYPADVPPPPPSSYPSNDHLPPPTGPSDSPY 256

  Fly   221 ------------------------AEEVLNNPNKLPS----PPVDEEKPGGFVPYVPTAQPN--- 254
                                    :.|  .:||.||:    |...|.......|:.|:...|   
plant   257 PHPYSHQPYHQDPPKHMPPPQNYSSHE--PSPNSLPNFQSYPSFSESSLPSTSPHYPSHYQNPEP 319

  Fly   255 --------PATAATIYQP--------------IVPV--------------AGVQITPDQMITAQK 283
                    ||.::|.:..              |.||              :..|..|:::..|.|
plant   320 YYSSPHSAPAPSSTSFSSAPPPPPYSSNGRINIAPVLDPAPSSAQKYHYDSSYQPGPEKVAEALK 384

  Fly   284 YCKYAGSALNYDDVKTAIENLQKALKLLSTGS 315
            ..::|..||.:|:|.||:|:|:|:|:||:..|
plant   385 AARFAVGALAFDEVSTAVEHLKKSLELLTNPS 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 44/132 (33%)
EXT-likeNP_194405.1 Vta1 16..142 CDD:282502 44/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2017
OMA 1 1.010
OrthoDB 1 1.010 D1450538at2759
OrthoInspector 1 1.000 T192713
orthoMCL 1 0.900 OOG5_129256
Panther 1 1.100 LDO PTHR46009
Phylome 1 0.910 0.909 Consistency score
87.980

Return to query results.
Submit another query.