DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and Vta1

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_079694.2 Gene:Vta1 MGIID:1913451 Length:309 Species:Mus musculus

Alignment Length:337 Identity:149/338 (44%)
Similarity:201/338 (59%) Gaps:59/338 (17%)


  Fly     4 PPCPPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKK 68
            ||.|...|||||.|:.|||||.||.|:||:.||||:|.|:|..::|.|..|.|..:||.||.:||
Mouse     8 PPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKK 72

  Fly    69 QYAENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSEE 133
            |..:|||:|.|:...||:||||||:|||||.:||...|.||::|:||::.:|.|::..||||::|
Mouse    73 QLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDE 137

  Fly   134 ALHNRKYAKWKAAYIHNCLKNGETPIPGPLPDDDDEAELEGENANASADTSPEDAAGAAAPAPYQ 198
            .:.:||||:|||.||||||||||||..||: ..::|.::| ||.:..|.:.|             
Mouse   138 NVKHRKYARWKATYIHNCLKNGETPQAGPV-GIEEENDVE-ENEDVGATSLP------------- 187

  Fly   199 PEPDSQPPAPSSPTT-----------SGV-VPPTAEEVLNNPNKL------------PSPPVDEE 239
                :|||.|||.:.           ||: :||.|....|.|.::            |||..   
Mouse   188 ----TQPPQPSSSSAYDPSNLAPGSYSGIQIPPGAHAPANTPAEVPHSTGVTSNAVQPSPQT--- 245

  Fly   240 KPGGFVPYVPTAQPNPATAATIYQPIVPVAGVQITPDQMITAQKYCKYAGSALNYDDVKTAIENL 304
                 ||..|...|:..||:.        ..:::||:....||||||||||||.|:||.||::||
Mouse   246 -----VPAAPAVDPDLYTASQ--------GDIRLTPEDFARAQKYCKYAGSALQYEDVGTAVQNL 297

  Fly   305 QKALKLLSTGSE 316
            ||||:||:||.|
Mouse   298 QKALRLLTTGRE 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 69/130 (53%)
Vta1NP_079694.2 Interaction with IST1. {ECO:0000250} 2..186 96/178 (54%)
Interaction with CHMP5. {ECO:0000250} 2..75 37/67 (55%)
Vta1 22..152 CDD:309683 69/130 (53%)
UBQ <183..>264 CDD:333228 24/105 (23%)
Interaction with VPS4B. {ECO:0000269|PubMed:15173323} 198..309 43/135 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150359022
eggNOG 1 0.900 E1_KOG0917
Hieranoid 1 1.000
Homologene 1 1.000 H6473
Inparanoid 1 1.050 274 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004767
OrthoInspector 1 1.000 T1085370
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46009
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1664
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.