DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and VTA1

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_057569.2 Gene:VTA1 HGNCID:20954 Length:307 Species:Homo sapiens

Alignment Length:329 Identity:154/330 (47%)
Similarity:203/330 (62%) Gaps:45/330 (14%)


  Fly     4 PPCPPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKK 68
            ||.|...|||||.|:.|||||.||.|:||:.||||:|.|:|..::|.|..|.|..:||.||.:||
Human     8 PPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKK 72

  Fly    69 QYAENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSEE 133
            |..:|||||.|:...||:||||||:|||||.:||...|.||::|:||::.:|.|::..||||::|
Human    73 QLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDE 137

  Fly   134 ALHNRKYAKWKAAYIHNCLKNGETPIPGPLPDDDDEAELEGENANASADTSPEDAAGAAAPAPYQ 198
            .:.:||||:|||.||||||||||||..||:..::|. ::| ||         |||..|:.|    
Human   138 NVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDN-DIE-EN---------EDAGAASLP---- 187

  Fly   199 PEPDSQPPAPSSPTT-----------SGV-VPPTAEEVLNNPNKLP-SPPVDEEKPGGFVPYVPT 250
                :||..|||.:|           :|: :||.|....|.|.::| |..|...          |
Human   188 ----TQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASN----------T 238

  Fly   251 AQPNPATAATIYQPI---VPVAGVQITPDQMITAQKYCKYAGSALNYDDVKTAIENLQKALKLLS 312
            .||.|.|...|...:   :....|::||:....||||||||||||.|:||.||::|||||||||:
Human   239 IQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALKLLT 303

  Fly   313 TGSE 316
            ||.|
Human   304 TGRE 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 70/130 (54%)
VTA1NP_057569.2 Interaction with IST1 2..186 100/189 (53%)
Interaction with CHMP5 2..75 37/67 (55%)
Vta1 22..152 CDD:309683 70/130 (54%)
Interaction with VPS4B. {ECO:0000250} 198..307 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150358564
eggNOG 1 0.900 E1_KOG0917
Hieranoid 1 1.000
Homologene 1 1.000 H6473
Inparanoid 1 1.050 277 1.000 Inparanoid score I2891
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1450538at2759
OrthoFinder 1 1.000 FOG0004767
OrthoInspector 1 1.000 T1075262
orthoMCL 1 0.900 OOG5_129256
Panther 1 1.100 LDO PTHR46009
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1664
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.