DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and vta1

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001008108.1 Gene:vta1 XenbaseID:XB-GENE-984112 Length:302 Species:Xenopus tropicalis

Alignment Length:320 Identity:142/321 (44%)
Similarity:199/321 (62%) Gaps:30/321 (9%)


  Fly     4 PPCPPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKK 68
            ||.|...:|:||.|:.||||:.||.|::|:.|||::|.|:|..:::.|..|.|..:||.||.:||
 Frog     6 PPLPAQFRSLQHHLRTAQEHEKRDPVVSYYCRLYSMQTGMKIDSKSPECRKFLSKLMDQLEALKK 70

  Fly    69 QYAENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSEE 133
            |..:.|:||.|:...||:||||||:|||||.:||...|.||:||:||::.:|.|.|..||||:||
 Frog    71 QLGDCESITQEIVGSAHVENYALKMFLYADNEDRAGRFNKNMVKSFYTASLLLDTLAVFGELTEE 135

  Fly   134 ALHNRKYAKWKAAYIHNCLKNGETPIPGPLPDDDDEAELEGENANASADTSPEDAAGAAAPAPYQ 198
            .:.:||||:|||.||||||||||||..||:..:.:|.:.|.|...:|:.::.|      :|:.||
 Frog   136 NIQHRKYARWKATYIHNCLKNGETPQAGPIGMEGEEYDEENEGEGSSSFSNRE------SPSAYQ 194

  Fly   199 PEPDSQPPAPSSPTTSGV-VPPTAEEVLNNPNKLP------SPPVDEEKPGGFVPYVPTAQPNPA 256
            |     |..| :|..:|: :||.|....|.|.::|      |..:....|..    :|...|:..
 Frog   195 P-----PNIP-TPNYTGIQIPPGAHAPANTPAEVPHSTGVASNAIAHPSPQN----IPAVDPSLY 249

  Fly   257 TAATIYQPIVPVAGVQITPDQMITAQKYCKYAGSALNYDDVKTAIENLQKALKLLSTGSE 316
            .|.|       ....::||:....|||:||||||||.|:||.||::|||||||||:||.|
 Frog   250 NAKT-------QGDARLTPEDFARAQKFCKYAGSALQYEDVNTAVQNLQKALKLLTTGRE 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 67/130 (52%)
vta1NP_001008108.1 Vta1 20..150 CDD:309683 67/130 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150362538
eggNOG 1 0.900 E1_KOG0917
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6473
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1450538at2759
OrthoFinder 1 1.000 FOG0004767
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.