DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and vta1

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005160712.1 Gene:vta1 ZFINID:ZDB-GENE-040426-2154 Length:303 Species:Danio rerio

Alignment Length:320 Identity:159/321 (50%)
Similarity:210/321 (65%) Gaps:30/321 (9%)


  Fly     7 PPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKKQYA 71
            ||.||:|||:|:.||||:.||.|:||:.||||:|.|:|..::|.|..|.|:.:||.||.|||:..
Zfish     4 PPQLKAIQHYLRTAQEHEKRDPVVAYYCRLYAMQTGMKLDSKTPECRKFLVKLMDQLEMMKKELG 68

  Fly    72 ENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSEEALH 136
            :||:|:.|:...|||||||||:|||||.:||.|.|.||::|:||:|.:|:|:|..|||||||.|.
Zfish    69 DNESISQEIVGNAHIENYALKMFLYADNEDRSERFHKNMIKSFYTSSLLFDVLSVFGELSEENLQ 133

  Fly   137 NRKYAKWKAAYIHNCLKNGETPIPGPLPDD----DDEAELEGENANASADTSPEDAAGAAAPAPY 197
            .|||||||||||||||||||||.|||:..:    |||...||...:.:.|..|.     :.|: :
Zfish   134 QRKYAKWKAAYIHNCLKNGETPQPGPIGMEGEAYDDEFGAEGGGPSQAPDNPPH-----SQPS-F 192

  Fly   198 QPEPDSQPPAPSSPTTSGVVPPTAEEVLNNPNKLPSP----PVDEEKPGGFVPYVPTAQP--NPA 256
            :..|..||  |:|..::..:||.:....|.|.::|.|    ||   ||   || ||...|  :|:
Zfish   193 RGHPSDQP--PTSNFSNIQIPPGSHAPANTPAEIPHPEAAQPV---KP---VP-VPRTMPVVDPS 248

  Fly   257 TAATIYQPIVPVAGVQITPDQMITAQKYCKYAGSALNYDDVKTAIENLQKALKLLSTGSE 316
            ......:     ..|::||:....||||||||||||.|:||.||::|||||||||:||.|
Zfish   249 LLNNTQE-----GDVRLTPEDFTRAQKYCKYAGSALQYEDVGTAVQNLQKALKLLTTGKE 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 76/130 (58%)
vta1XP_005160712.1 Vta1 15..145 CDD:282502 76/130 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150361453
eggNOG 1 0.900 E1_KOG0917
Hieranoid 1 1.000
Homologene 1 1.000 H6473
Inparanoid 1 1.050 295 1.000 Inparanoid score I2683
OMA 1 1.010
OrthoDB 1 1.010 D1450538at2759
OrthoFinder 1 1.000 FOG0004767
OrthoInspector 1 1.000 T1054514
orthoMCL 1 0.900 OOG5_129256
Panther 1 1.100 LDO PTHR46009
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1664
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.