DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and Vta1

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_006227708.1 Gene:Vta1 RGDID:1305031 Length:309 Species:Rattus norvegicus

Alignment Length:338 Identity:151/339 (45%)
Similarity:203/339 (60%) Gaps:61/339 (18%)


  Fly     4 PPCPPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKK 68
            ||.|...|||||.|:.|||||.||.|:||:.||||:|.|:|..::|.|..|.|..:||.||.:||
  Rat     8 PPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKK 72

  Fly    69 QYAENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSEE 133
            |..:|||:|.|:...||:||||||:|||||.:||...|.||::|:||::.:|.|::..||||::|
  Rat    73 QLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDE 137

  Fly   134 ALHNRKYAKWKAAYIHNCLKNGETPIPGPLP-DDDDEAELEGENANASADTSPEDAAGAAAPAPY 197
            .:.:||||:|||.||||||||||||..||:. ::|::.|   ||.:..|.:.|            
  Rat   138 NVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDVE---ENEDVGATSLP------------ 187

  Fly   198 QPEPDSQPPAPSSPTT-----------SGV-VPPTAEEVLNNPNKL------------PSPPVDE 238
                 :|||.|||.:|           ||: :||.|....|.|.::            |||..  
  Rat   188 -----TQPPQPSSSSTYDPSNLAAGSYSGIQIPPGAHAPANTPAEVPHSTGVTSNAVQPSPQT-- 245

  Fly   239 EKPGGFVPYVPTAQPNPATAATIYQPIVPVAGVQITPDQMITAQKYCKYAGSALNYDDVKTAIEN 303
                  ||.:|...|:..||:.        ..|::||:....||||||||||||.|:||.||::|
  Rat   246 ------VPAIPAIDPDLYTASQ--------GDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQN 296

  Fly   304 LQKALKLLSTGSE 316
            |||||:||:||.|
  Rat   297 LQKALRLLTTGRE 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 69/130 (53%)
Vta1XP_006227708.1 Vta1 22..152 CDD:282502 69/130 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150362184
eggNOG 1 0.900 E1_KOG0917
Hieranoid 1 1.000
Homologene 1 1.000 H6473
Inparanoid 1 1.050 210 1.000 Inparanoid score I3547
OMA 1 1.010
OrthoDB 1 1.010 D1450538at2759
OrthoFinder 1 1.000 FOG0004767
OrthoInspector 1 1.000 T1088916
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46009
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.