DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and SPAC13F5.04c

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_593652.2 Gene:SPAC13F5.04c PomBaseID:SPAC13F5.04c Length:389 Species:Schizosaccharomyces pombe

Alignment Length:380 Identity:101/381 (27%)
Similarity:172/381 (45%) Gaps:84/381 (22%)


  Fly     7 PPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETK-LLLGIMDWLEQMKKQY 70
            |..|:|||.|::...|.:..:.|||||:..:|.|:.|.:|.....|.| .||.:::.||.::|..
pombe     8 PKELQSIQPFVRRFNELEAHNPVIAYWSLYWAAQMALSSSHGVSNECKDFLLSLIEHLEDLRKNL 72

  Fly    71 AENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSEEAL 135
            .|||.:::|.:|:|::|:::|::.:.|::..:.   ||..|:|:.::....::.:.:|..:|:..
pombe    73 GENENVSDETSAKAYVESFSLEVLVQAERNSKN---GKPDVQAYLAARDFLELSRIWGPPTEQIT 134

  Fly   136 HNRKYAKWKAAYIHNCLKNGETPI-------------PGPLPDDDDEAELEGENANASADTS--- 184
            .:.|:.|.:|..:.|..:..:||.             ...||  ..||.:| .||:||.:||   
pombe   135 KSIKFCKLRALQVANPQRKAKTPSNHATEELQQSSTNSTTLP--TQEAAVE-TNASASHETSFAL 196

  Fly   185 PEDAAGAA---AP---APYQPEPD---------SQPPAPS--------SPTTSGVVPPTAEEVLN 226
            |..:..|:   :|   |....||:         |.|.||.        .|||   .|.|.....|
pombe   197 PTTSPAASLSISPTKSAAVSSEPNVEADVKSLSSTPAAPQLNSPSHSYEPTT---FPSTTSITEN 258

  Fly   227 NPNKLPS------------PPVDEEKPGGFVPYVPTA--------QPNPA-----------TAAT 260
            .|...|:            .|..::...|..|..||:        .|:.|           |.|.
pombe   259 LPTIDPTRSTRSSSHIQSLSPESKQTSDGHRPPSPTSITTTSTSIDPSVAFSSKSTLATTRTNAP 323

  Fly   261 IYQPIVPVAGVQITP----DQMITAQKYCKYAGSALNYDDVKTAIENLQKALKLL 311
            :.:|..|.....:..    :.:.:|:.:.:||.|||:|:|..|||.:|:.|||||
pombe   324 LSRPSQPTKASPLNKFSALEAIQSARSHARYAYSALDYEDTTTAIHHLKSALKLL 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 35/131 (27%)
SPAC13F5.04cNP_593652.2 Vta1 19..145 CDD:282502 35/129 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1650
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004767
OrthoInspector 1 1.000 T1125847
orthoMCL 1 0.900 OOG5_129256
Panther 1 1.100 LDO PTHR46009
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1664
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.