DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vta1 and T23G11.7

DIOPT Version :10

Sequence 1:NP_647640.1 Gene:Vta1 / 38204 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001379199.1 Gene:T23G11.7 / 172528 WormBaseID:WBGene00011972 Length:361 Species:Caenorhabditis elegans


Alignment Length:50 Identity:20/50 - (40%)
Similarity:30/50 - (60%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLL 56
            ||:.|.|.|::|:|.|:.:||.||.||: |..:.:|...:|......|||
 Worm     6 PPAFKPIAHYIKIANENASRDPVIYYWS-LLCMALGPVETTFDEISWKLL 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:461380 14/38 (37%)
Vta1_C 275..311 CDD:465647
T23G11.7NP_001379199.1 CwlO1 94..>165 CDD:443091
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.