DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vta1 and T23G11.7

Sequence 1:NP_647640.1 Gene:Vta1 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_492138.1 Gene:T23G11.7 WormBaseID:WBGene00011972 Length:361 Species:Caenorhabditis elegans

Alignment Length:50 Identity:20/50 (40%)
Similarity:30/50 (60%) Gaps:1/50 (2%)


  Fly     7 PPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLL 56
            ||:.|.|.|::|:|.|:.:||.||.||: |..:.:|...:|......|||
 Worm     6 PPAFKPIAHYIKIANENASRDPVIYYWS-LLCMALGPVETTFDEISWKLL 54

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:282502 15/39 (38%)
T23G11.7NP_492138.1 MT <6..172 CDD:289543 20/50 (40%)
Atg14 52..310 CDD:287195 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6473
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129256
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1664
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.