powered by:
Protein Alignment Vta1 and T23G11.7
DIOPT Version :9
Sequence 1: | NP_647640.1 |
Gene: | Vta1 / 38204 |
FlyBaseID: | FBgn0035251 |
Length: | 316 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379199.1 |
Gene: | T23G11.7 / 172528 |
WormBaseID: | WBGene00011972 |
Length: | 361 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 20/50 - (40%) |
Similarity: | 30/50 - (60%) |
Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLL 56
||:.|.|.|::|:|.|:.:||.||.||: |..:.:|...:|......|||
Worm 6 PPAFKPIAHYIKIANENASRDPVIYYWS-LLCMALGPVETTFDEISWKLL 54
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Vta1 | NP_647640.1 |
Vta1 |
18..148 |
CDD:398366 |
14/38 (37%) |
Vta1_C |
275..311 |
CDD:407932 |
|
T23G11.7 | NP_001379199.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H6473 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1664 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.