DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vta1 and T23G11.7

DIOPT Version :9

Sequence 1:NP_647640.1 Gene:Vta1 / 38204 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001379199.1 Gene:T23G11.7 / 172528 WormBaseID:WBGene00011972 Length:361 Species:Caenorhabditis elegans


Alignment Length:50 Identity:20/50 - (40%)
Similarity:30/50 - (60%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLL 56
            ||:.|.|.|::|:|.|:.:||.||.||: |..:.:|...:|......|||
 Worm     6 PPAFKPIAHYIKIANENASRDPVIYYWS-LLCMALGPVETTFDEISWKLL 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:398366 14/38 (37%)
Vta1_C 275..311 CDD:407932
T23G11.7NP_001379199.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6473
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1664
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.