DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13926 and SPBC21H7.06c

Sequence 1:NP_647633.1 Gene:CG13926 FlyBaseID:FBgn0035243 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_595931.1 Gene:SPBC21H7.06c PomBaseID:SPBC21H7.06c Length:200 Species:Schizosaccharomyces pombe

Alignment Length:209 Identity:71/210 (34%)
Similarity:109/210 (52%) Gaps:33/210 (16%)


  Fly     3 LFGLIVSGRLPQSDFVAVDATKLLVNVPDIESVNYLVVFLTGVSPLPVGTSAAIYFSWPDANAAP 67
            :||.|.:|||.|::...|...:.:..:...||:|::||||...||.|||..|.:||.||    ..
pombe     1 MFGAICAGRLVQTNLQQVADNQFVFQLDSAESLNHIVVFLLPNSPFPVGMGAKVYFQWP----GK 61

  Fly    68 TWQYLGHINNTKPSAIFKIAQLKKSHELEAQAHGMVFGSQEISHIAQIGVSLEPELTVAQQTPAV 132
            .:|:||::.|.||||||::....::........|:.         |.:|:|:|| ||...:||||
pombe    62 PFQFLGYLTNEKPSAIFRLKNTIQTLSENENCVGIT---------AMLGISVEP-LTNFTETPAV 116

  Fly   133 STANDN---------KQFGQRMLENFFNYASSFGVAARDIPPIS--------SETFVPFSVVQNW 180
            ||:..|         ....|::|.|.:|:.:||  |...:||.|        ::||:|..|.|:|
pombe   117 STSASNVIAKPLPPVTSVAQKILTNLYNFLASF--ATSQLPPNSIGLGDLRPNDTFIPLRVFQDW 179

  Fly   181 YTNFQRRMEQNPNF 194
            :..|..::..||||
pombe   180 HAKFLNKLSNNPNF 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13926NP_647633.1 DUF775 3..192 CDD:283295 68/206 (33%)
SPBC21H7.06cNP_595931.1 DUF775 1..191 CDD:283295 68/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6908
Inparanoid 1 1.050 117 1.000 Inparanoid score I1507
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004524
OrthoInspector 1 1.000 T1125850
orthoMCL 1 0.900 OOG5_129748
Panther 1 1.100 LDO PTHR12925
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R869
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.