DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and Rcbtb1

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_001347539.1 Gene:Rcbtb1 / 71330 MGIID:1918580 Length:531 Species:Mus musculus


Alignment Length:181 Identity:41/181 - (22%)
Similarity:74/181 - (40%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1113 LGEDLLKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQ---SVVSLQGYSYAA 1174
            :.|.|.|.|......|:...:.|:.|..||.:|:.||::|.:|...:.::   .|:.:..:||..
Mouse   356 VAESLKKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV 420

  Fly  1175 VHFALCHIYSGASH--PPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHN-FHKPCS----- 1231
            ....|.::|:....  |.|.|.|::||                    |:||.| ..:.|.     
Mouse   421 YRAFLQYLYTDTVDLPPEDAIGLLDLA--------------------TSYCENRLKRLCQHIIKR 465

  Fly  1232 GCS-DGILQVLPVALNHALDDLYRKCLRWTCRHYLKVWPTRQFAQLPPDIL 1281
            |.: :....:...|:.:..:||...|.::...|..:|..|..|.|:...:|
Mouse   466 GITVENAFSLFSAAVRYDAEDLEEFCFKFCINHLTEVTQTAAFWQMDGPLL 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 18/70 (26%)
BTB 1128..>1191 CDD:197585 16/67 (24%)
BACK 1238..>1281 CDD:197943 9/42 (21%)
Rcbtb1NP_001347539.1 RCC1 1 40..91
ATS1 43..>316 CDD:227511
RCC1 2 93..145
RCC1 3 147..198
RCC1 4 199..250
RCC1 5 252..302
RCC1 6 304..356 41/181 (23%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662 30/129 (23%)
BACK_RCBTB1 466..531 CDD:350603 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.