DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12004 and YKR051W

Sequence 1:NP_001097474.1 Gene:CG12004 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_012977.3 Gene:YKR051W SGDID:S000001759 Length:418 Species:Saccharomyces cerevisiae

Alignment Length:406 Identity:114/407 (28%)
Similarity:165/407 (41%) Gaps:100/407 (25%)


  Fly    73 CVWAALFITCQQIY---QHLRWYTNPQEQRWIVRILFIVPIYATYSWISLLFFNSDNVYIYFFTV 134
            ||::::..|....|   :||..|..|.|||..:|||.:|||::......::  ..:....|...:
Yeast    14 CVYSSIIATIISFYTITRHLLNYRKPYEQRLSIRILLLVPIFSVSCASGII--KPEAAQFYVDPI 76

  Fly   135 RDCYEAFVIYNFLSLCYEYLGGEGNIMSEI------RGKPIKTSCLYGTCCLKGKTYTIG----F 189
            |:.|||||||.|.:.....||||.||::.:      ...||.   |.|..|   |...:.    |
Yeast    77 REFYEAFVIYTFFTFLTLLLGGERNIITVLSLNHAPTRHPIP---LIGKIC---KPIDLSDPFDF 135

  Fly   190 LRFCKQATLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITIIYNISVSLALYGLYLFYF 254
            | |.|:..||:...||...|..:...|        |......|::.:.|||||:.:||.|.||:.
Yeast   136 L-FVKKGILQYVWFKPFYCFGTLICSA--------WKLPKFEIFLNVFYNISVTWSLYSLALFWK 191

  Fly   255 ATRDLLTPFEPVLKFCTIKSVIFLSFWQGV---GLAILEKANVISPIVDSAGTVTVEPGTVSAGY 316
            .....|||::|.|||..:|.:||.|:||.:   ||.:..|.        ..|......|.|   |
Yeast   192 CLYPELTPYKPWLKFLCVKLIIFASYWQSIIIQGLVVTGKL--------GTGNQDRTSGYV---Y 245

  Fly   317 QNFFICIEMLFAAIALRYAFPYQVYARSCISDGHGRSVTMQSISSSLKETMNPKDIMTD------ 375
            :|..:||||:..||....|||:..|....|..|    ..|:.| .:||:.:...|::.|      
Yeast   246 KNGLLCIEMVPFAILHAVAFPWNKYTAFSIPYG----ARMKFI-YALKDFLGCGDLIWDFKQTLF 305

  Fly   376 ------AIHNFHPQYQQY--TQYSSG---------------GKNSRGIRVSSYD----------- 406
                  ...||.|:....  |:..||               |:||..:...|.|           
Yeast   306 AGPLYYNYRNFDPEAMDLLSTRQQSGATMERLKHGLRFTDNGRNSYWVAYGSIDNNLVPESIEES 370

  Fly   407 -----------PDDPS 411
                       |:||:
Yeast   371 WEDDIAGQRTFPEDPN 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:281602 91/282 (32%)
YKR051WNP_012977.3 Solute_trans_a 14..267 CDD:308940 91/281 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I1308
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000667
OrthoInspector 1 1.000 T634422
orthoMCL 1 0.900 OOG5_126850
Panther 1 1.100 LDO PTHR23423
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1529
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.