DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12004 and AT5G26740

Sequence 1:NP_001097474.1 Gene:CG12004 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001078625.1 Gene:AT5G26740 AraportID:AT5G26740 Length:422 Species:Arabidopsis thaliana

Alignment Length:388 Identity:149/389 (38%)
Similarity:216/389 (56%) Gaps:30/389 (8%)


  Fly    68 VLAGVCVWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWISLLFFNSDNVYIYFF 132
            ::|.:|...|:.:....||:||..||.|..||:||||:|:||:||..|::||:...|.   |||.
plant    11 IVAFLCTVGAIALAIFHIYRHLLNYTEPTYQRYIVRIIFMVPVYAFMSFLSLVLPKSS---IYFD 72

  Fly   133 TVRDCYEAFVIYNFLSLCYEYLGGEGNIMSEIRGKPIKTSCLYGTCCLKGKTYTIGFLRFCKQAT 197
            ::|:.|||:|||||||||..::||.|:::..:.|:.:|.|....|||....|....|:|.|||..
plant    73 SIREVYEAWVIYNFLSLCLAWVGGPGSVVLSLSGRSLKPSWSLMTCCFPPLTLDGRFIRRCKQGC 137

  Fly   198 LQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITIIYNISVSLALYGLYLFYFATRDLLTP 262
            |||.::||::..:.:.|.|.|.|.||:::.|..|:|:||||.||.::|||.|.|||.|.||||.|
plant   138 LQFVILKPILVAVTLVLYAKGKYKDGNFNPDQAYLYLTIIYTISYTVALYALVLFYMACRDLLQP 202

  Fly   263 FEPVLKFCTIKSVIFLSFWQGVGLAILEKANVISPIVDSAGTVTVEPGTVSAGYQNFFICIEMLF 327
            |.||.||..||||:||::||||.:.:..|:..|            :....:|.:|||.||:|||.
plant   203 FNPVPKFVIIKSVVFLTYWQGVLVFLAAKSGFI------------KSAEAAAHFQNFIICVEMLI 255

  Fly   328 AAIALRYAFPYQVYARSCISDGHGRSVTMQSISSSLKETMNPKDIMTDAIHNFHPQYQQYTQYS- 391
            ||....|||||:.||.:.:. |.|      |.|.||...:...|...|.:|.|.|.|..|..|: 
plant   256 AAACHFYAFPYKEYAGANVG-GSG------SFSGSLSHAVKLNDFYHDTVHQFAPTYHDYVLYNH 313

  Fly   392 --SGGKNSRGIRVSSYDPDDPSSGAAAGGMQASQPT-SGGYDAVATGPGSGGNGGSNCMASKT 451
              .|.:.::..|..::.|    :|.....|:.::|. :...|.|:..........|...:|.|
plant   314 QDGGDEGTKKYRSRTFVP----TGQEMDAMRKNKPVYANKIDGVSVSSSLSSEASSPKSSSVT 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:281602 122/271 (45%)
AT5G26740NP_001078625.1 Solute_trans_a 11..268 CDD:281602 122/272 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I964
OMA 1 1.010
OrthoDB 1 1.010 D462913at2759
OrthoInspector 1 1.000 T124801
orthoMCL 1 0.900 OOG5_126850
Panther 1 1.100 LDO PTHR23423
Phylome 1 0.910 0.800 Consistency score
76.980

Return to query results.
Submit another query.