DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12004 and tmem184a

Sequence 1:NP_001097474.1 Gene:CG12004 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_998685.2 Gene:tmem184a ZFINID:ZDB-GENE-040426-2925 Length:420 Species:Danio rerio

Alignment Length:500 Identity:253/500 (51%)
Similarity:307/500 (61%) Gaps:95/500 (19%)


  Fly     1 MSTTAASLIEAALNASSGNATATTAGSLEATGKPNYVVQVKNTPMSTPLDPLLH----------- 54
            |:.|...::.|:.:.:..|...           |:|.:...||       .||:           
Zfish     1 MNETTLRILSASSDKNMDNVPL-----------PSYSLLSNNT-------DLLNKTVIRSANGTE 47

  Fly    55 --VGDGIFLQTKTAQVLAGVCVWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWI 117
              ..|.|||.|.|||.|:|:.||:||.:||.|||.|||.||.|.|||:|:||||||||||..||:
Zfish    48 VVADDQIFLSTATAQALSGIFVWSALILTCHQIYLHLRSYTVPNEQRYIIRILFIVPIYAFDSWL 112

  Fly   118 SLLFFNSDNVYIYFFTVRDCYEAFVIYNFLSLCYEYLGGEGNIMSEIRGKPIKTSCLYGTCCLKG 182
            ||||..:|..|:||.:||||||||||||||||.:||||||..||||||||||::|||||||||.|
Zfish   113 SLLFITNDQYYVYFDSVRDCYEAFVIYNFLSLSFEYLGGESAIMSEIRGKPIQSSCLYGTCCLVG 177

  Fly   183 KTYTIGFLRFCKQATLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITIIYNISVSLALY 247
            .:|:|||||||||||||||:|||::|.|.|.|||||.|||||::..|||:|||||||.|||||||
Zfish   178 MSYSIGFLRFCKQATLQFCVVKPIMAVITILLQAFGKYHDGDFNVTGGYLYITIIYNFSVSLALY 242

  Fly   248 GLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVGLAILEKANVI--SPIVDSAGTVTVEPG 310
            .|:||||||.|||.||||||||.|||||||||||||:.|||||:..||  :..:|..   .|..|
Zfish   243 ALFLFYFATSDLLRPFEPVLKFLTIKSVIFLSFWQGMVLAILERCGVIPEAQFIDGH---EVGAG 304

  Fly   311 TVSAGYQNFFICIEMLFAAIALRYAFPYQVYARSCISDGHGRSVTMQSISSSLKETMNPKDIMTD 375
            ||:||:|||.|||||.||:|||||||...|| |...::.......|..|||.||||:||.|::.|
Zfish   305 TVAAGWQNFIICIEMFFASIALRYAFTSSVY-REKKNEAPENVAPMHGISSGLKETINPGDMVQD 368

  Fly   376 AIHNFHPQYQQYTQYSSGGKNSRGIRVSSYDPDDPSSGAAAGGMQASQPTSGGYDAVATGPGSGG 440
            |||||.|.||||||.|:                          .:..||::.|...::|      
Zfish   369 AIHNFSPAYQQYTQQST--------------------------QEVVQPSANGKPGIST------ 401

  Fly   441 NGGSNCMASKTLGNQRKFQPGGQRVATISQNYNEKTMLLSSDDEY 485
                    ||                  |...::|.||:.:|||:
Zfish   402 --------SK------------------STKKSDKVMLIDTDDEF 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:281602 196/275 (71%)
tmem184aNP_998685.2 Solute_trans_a 61..333 CDD:281602 196/275 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D411703at33208
OrthoFinder 1 1.000 FOG0000667
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126850
Panther 1 1.100 LDO PTHR23423
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.