DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12004 and TMEM184B

Sequence 1:NP_001097474.1 Gene:CG12004 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_016884243.1 Gene:TMEM184B HGNCID:1310 Length:452 Species:Homo sapiens

Alignment Length:483 Identity:262/484 (54%)
Similarity:307/484 (63%) Gaps:88/484 (18%)


  Fly    15 ASSGNATATTAGSLEATGKPNYVVQVKNTPMSTPLDPLLHVGDGIFLQTKTAQVLAGVCVWAALF 79
            ||...|.|:.:.|:...|.|        |.|..|          :||.|..||.::|..||.||.
Human    46 ASPTTAAASPSVSVIPEGSP--------TAMEQP----------VFLMTTAAQAISGFFVWTALL 92

  Fly    80 ITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWISLLFFNSDNVYIYFFTVRDCYEAFVIY 144
            |||.|||.|||.|:.|.|||:||||||||||||..||:|||||.:|..|:||.||||||||.|||
Human    93 ITCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEALVIY 157

  Fly   145 NFLSLCYEYLGGEGNIMSEIRGKPIKTSCLYGTCCLKGKTYTIGFLRFCKQATLQFCLVKPLVAF 209
            |||||||||||||.:||||||||||::||:||||||.||||:|||||||||||||||:||||:|.
Human   158 NFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQFCVVKPLMAV 222

  Fly   210 IIIFLQAFGHYHDGDWSADGGYIYITIIYNISVSLALYGLYLFYFATRDLLTPFEPVLKFCTIKS 274
            ..:.|||||.|.|||:....||:|:|||||||||||||.|:|||||||:||:|:.|||||..:||
Human   223 STVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKS 287

  Fly   275 VIFLSFWQGVGLAILEKANVISPIVDSAGTVTVEPGTVSAGYQNFFICIEMLFAAIALRYAFPYQ 339
            |||||||||:.||||||...| |.:.|| .|:|..|||:||||:|.||:||.|||:|||:||.|:
Human   288 VIFLSFWQGMLLAILEKCGAI-PKIHSA-RVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYK 350

  Fly   340 VYARSCISDGH------------GRSVTMQSISSSLKETMNPKDIMTDAIHNFHPQYQQYTQYSS 392
            |||...: |..            ||...|:||||||||||||.||:.||||||.|.||||||.  
Human   351 VYADKRL-DAQASSPAPPAPCPAGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPAYQQYTQQ-- 412

  Fly   393 GGKNSRGIRVSSYDPDDPSSGAAAGGMQASQPTSGGYDAVATGPGSGGNGGSNCMASKTLGNQRK 457
                      |:.:| .|:....|.|:..|...||..|                           
Human   413 ----------STLEP-GPTWRGGAHGLSRSHSLSGARD--------------------------- 439

  Fly   458 FQPGGQRVATISQNYNEKTMLLSSDDEY 485
                           ||||:|||||||:
Human   440 ---------------NEKTLLLSSDDEF 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:281602 195/273 (71%)
TMEM184BXP_016884243.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2641
Hieranoid 1 1.000
Homologene 1 1.000 H6396
Inparanoid 1 1.050 473 1.000 Inparanoid score I1488
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D411703at33208
OrthoFinder 1 1.000 FOG0000667
OrthoInspector 1 1.000 T608391
orthoMCL 1 0.900 OOG5_126850
Panther 1 1.100 O PTHR23423
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1529
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.