DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7879 and rbm12b

Sequence 1:NP_647626.1 Gene:CG7879 FlyBaseID:FBgn0035235 Length:985 Species:Drosophila melanogaster
Sequence 2:XP_002934460.1 Gene:rbm12b ID: Length:659 Species:Xenopus tropicalis

Alignment Length:1027 Identity:205/1028 (20%)
Similarity:329/1028 (32%) Gaps:412/1028 (40%)


  Fly     1 MSVIIRLQNLPWTANARDIRNFFSGLSIPEGGVHIIGGEMGDAFIAFSTDEDARCAMLKDREKLM 65
            |:|:||||.||..|.:.|||:|||||.||:|||||.||::|:|||.|:||||||.||.:....:.
 Frog     1 MAVVIRLQGLPVVAGSTDIRHFFSGLHIPDGGVHITGGKIGEAFIIFATDEDARRAMSRSGGFIK 65

  Fly    66 EIQVRLLLSSRAEMQKVIETARKAASAQAPVSVPVPMPVVVPVTAAKVAGPAAPLPPIIGGLNTF 130
            :.::.|.|||:||||..:|..||                     ..|..||...:..::..:.  
 Frog    66 KSRIELFLSSKAEMQHTLEMNRK---------------------GNKDLGPTPDISKLLNVMK-- 107

  Fly   131 LGQGQVKGVATGTVPSFLTYQQQAGITLSDVTGRRSRSRSSSSDDSDRERERDRQRERERGRKRR 195
                  ||:          ||:                                           
 Frog   108 ------KGI----------YQK------------------------------------------- 113

  Fly   196 SDRLDKSQERELKMVAGGGALPSPWAQPPQNQLPAVGLGLNMGLNLNLPQIPSLQSYTTSTTTTN 260
                                                                            |
 Frog   114 ----------------------------------------------------------------N 114

  Fly   261 VTNNYNLEPSATSVQLLTALQQVSSGSAAPAQPSKSESEPIAFASVNPYAQMYPQLFQQQQMLLQ 325
            :.|..|:|....           |||:.                            :.::.|...
 Frog   115 MANKSNVEAGFD-----------SSGAK----------------------------YTEENMPRP 140

  Fly   326 QQQTQAKVSPTMGGSPGGGSTPQVVADTCYIRMSGMCQNTSYSDIRKYFQGMYIP--HNGIKIMM 388
            :.|.:..:.|......|            |:.:.|:.......|::::|.|..:.  |..::   
 Frog   141 KYQGKKDIWPLKDNGYG------------YVFLYGLPYTAGELDVKEFFHGFNVVDLHFSVR--- 190

  Fly   389 VNGSRTGVAYVEFSRVSSAQKAVQRNNTMFRDRLIQI--------VPVGDDEFEMAEE-RASRQ- 443
            .||.|.|.|||:|..|..||.|:.|:|.....|.|.:        :..|....|..|. |.:|| 
 Frog   191 QNGVRDGNAYVKFGSVQDAQAALSRDNEYIGHRYICVKLCNEQKWIEAGGPTDERNESVRKNRQW 255

  Fly   444 -------GQDGSRSHGNHNGGDRGERGGGAPVPVPRPVTNVLYIEDLPQTTTEQDIMKMFSASYT 501
                   ....|||...|....|.          |......|::.::..:..:.|| |:|.....
 Frog   256 SPRFPSKNHSRSRSPKIHRTRSRS----------PHNQQFYLHLLNMSYSVQKTDI-KLFFGDPD 309

  Fly   502 VVD----ILLSPSPKNRRESVAFVLFAREAEADSALQDTSKHYIGFRQLRVRSSSEEDMQNAKEK 562
            :.|    :||..:....||  .|||...|......| ...|..:..|::.|...:.:||.     
 Frog   310 IPDTQIKLLLDRNGVQTRE--GFVLIKNEKFYQKCL-GLHKGLLNGREVWVYPIARKDML----- 366

  Fly   563 QRRANEQLLKEEADQREELLKDQQRRQKQQQQENENIQANRFAADPRRRQAEDQQQQQQMNMGPN 627
                             ||::..:|:|.::                                   
 Frog   367 -----------------ELIESSERQQLER----------------------------------- 379

  Fly   628 FNSNMSPNMMAPFVNGGNMPFHMPPLQQNGVNNFPFNMNNN---YNYNGNSNGNGPNYPNDNGGA 689
             |::..|:....|.:..|:..:|      .:.|||||::.:   ..:.|        :|.|    
 Frog   380 -NTSEDPSPKKKFRDRSNLKRYM------YLRNFPFNVSKSEVQKFFAG--------FPVD---- 425

  Fly   690 GVIQRPRQEDVFVRVHNCEYATRANDLGE---LFSLEHLRIEHIEQLFNERNQSSGEFIV-EFSD 750
                   ::|:|:.     |.:|...|||   .|..||..|  :.:..|::.....|.:: ..|:
 Frog   426 -------EQDIFLL-----YDSRGVGLGEALVTFPSEHQAI--LAEGLNQQKFLGTEVLLRRISE 476

  Fly   751 PASCKL-AIREFHNRR--FRGRGLRVVAITPQ----EIADRMKKPFMDYLPGGNGPRKAETNNAN 808
            ....:| |..|.||.|  .|....|...:.|.    |::|...:.:       :.||....::..
 Frog   477 EQMKELGAFPEDHNEREPKRSTSYRDEYLEPAEQGFEVSDYGHRSY-------DQPRPYRDDDFG 534

  Fly   809 DGAGGNKASAQPSRRRGPSRFDKPQEQPSQQQDRPLSLEREDNSSTS--SNAPVKQHFNPFARPD 871
            .|:|        |.||.|.|...|.:   ..||.|.......|.:..  .:.|:           
 Frog   535 HGSG--------SIRRSPERLRSPYD---MNQDEPYGRFHMGNQNVEDYKSGPI----------- 577

  Fly   872 PPLSSSSLSPSNQGQVKPTSPVPVPTSIIPDKFNRP---GCVVAMRNVPFKAELKDIMRFFSDYK 933
                                             |||   |..:.::|||:.|.:::|:.||..|.
 Frog   578 ---------------------------------NRPRSGGASIRLKNVPYTATIEEILDFFYGYN 609

  Fly   934 LSPDDIIRRFNDEGKPTGDTRVAFESPSEARSAFESRRKKQIFNRTVYLDII 985
            :.||.:...:|.:|...    |..|:..||.:|.....::.|..|.|::.||
 Frog   610 VVPDSVEMDYNCKGTAI----VHMENYDEAAAAVNELNERPIGPRKVHMSII 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7879NP_647626.1 RRM1_RBM12_like 2..75 CDD:240954 41/73 (56%)
RRM_hnRNPH_ESRPs_RBM12_like 355..425 CDD:240700 22/72 (31%)
RRM <364..551 CDD:223796 50/210 (24%)
RRM_SF 478..549 CDD:240668 18/75 (24%)
RRM_SF 702..773 CDD:240668 20/78 (26%)
RRM_hnRNPH_ESRPs_RBM12_like 910..982 CDD:240700 20/72 (28%)
rbm12bXP_002934460.1 RRM1_RBM12B 2..80 CDD:241188 45/78 (58%)
RRM_SF 158..229 CDD:302621 22/74 (30%)
RRM3_RBM12B 285..365 CDD:240957 19/84 (23%)
RRM <361..566 CDD:223796 57/313 (18%)
RRM_SF 401..474 CDD:302621 22/105 (21%)
RRM_SF 585..657 CDD:302621 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3701
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132643at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T602097
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R11245
TreeFam 00.000 Not matched by this tool.
44.090

Return to query results.
Submit another query.