DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12099 and RNF10

Sequence 1:NP_647623.1 Gene:CG12099 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_001317403.1 Gene:RNF10 HGNCID:10055 Length:816 Species:Homo sapiens

Alignment Length:854 Identity:264/855 (31%)
Similarity:395/855 (46%) Gaps:206/855 (24%)


  Fly     1 MDSNNSSNSKKQPQSSHHG----KSSSA----ESQRKSSELHTNSNKQRHSRRRNQVPTPRND-- 55
            ||.|:.|||......|..|    :|:||    ||:.||...:::.:| |::|:| ::..|:|:  
Human    15 MDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGSK-RYNRKR-ELSYPKNESF 77

  Fly    56 QQQQPQQPAKLRPNVDKRPKARGFGGGYDFPSPRG---QDGASGSSRLAYSATGYSRSGDFDHEL 117
            ..|..:..::.....:|.|..||.|....|.|...   :|..:.:.|..:|...:|         
Human    78 NNQSRRSSSQKSKTFNKMPPQRGGGSSKLFSSSFNGGRRDEVAEAQRAEFSPAQFS--------- 133

  Fly   118 NSVYTQGSKKQNLNHLLNFHCVPRELERGHHHQAQQHHGLSGRKQR-----YNKEQFLQANFQFV 177
                  |.||.||||||||...||. :.||...:  .||..|::.:     :|||.|||||.|||
Human   134 ------GPKKINLNHLLNFTFEPRG-QTGHFEGS--GHGSWGKRNKWGHKPFNKELFLQANCQFV 189

  Fly   178 IRSGAKAQVN-GSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLS 241
            :........: ..||.|::|.::||:.|.:.|...||||||||.|||:|||||.:||.|:|||||
Human   190 VSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLS 254

  Fly   242 LSDKTWRKCPICYDAIHAGDLKSCTIEQLRDLQVGEKITFQLMRRRKG-------SMYIE-NHVA 298
            ||:|||.||||||.::|..||||....:.....||:.||.|||:|.||       |.::. :|..
Human   255 LSEKTWSKCPICYSSVHKKDLKSVVATESHQYVVGDTITMQLMKREKGVLVALPKSKWMNVDHPI 319

  Fly   299 GLGETIERFPFVSAGEEAKRYSKFLIAKRMDV--AAIIERE--RNELLAESDVSCPEDVFIQQAL 359
            .||:           |:..:|||.|:|.:..|  ..::|.:  ..:.||| :...||..||:.|:
Human   320 HLGD-----------EQHSQYSKLLLASKEQVLHRVVLEEKVALEQQLAE-EKHTPESCFIEAAI 372

  Fly   360 VMLQER--------------------VEKLGVEKPDPKED--------------------EEETA 384
            ..|:.|                    :|:|.:..|..||.                    :|||.
Human   373 QELKTREEALSGLAGSRREVTGVVAALEQLVLMAPLAKESVFQPRKSLLQQGVLEYLSAFDEETT 437

  Fly   385 PVLCLET-------------------------ETKIDIEKSDDASISSGEASSSLSYSS------ 418
            .|..|:|                         |...|:|.:|| ::..|...:..|...      
Human   438 EVCSLDTPSRPLALPLVEEEEAVSEPEPEGLPEACDDLELADD-NLKEGTICTESSQQEPITKSG 501

  Fly   419 ----NHNKYYYFYQSNDGQNIYLHPLNVKMLQACYGTLDLGPLLIEAQIVQMEQHSMDEEHRRKF 479
                :.:..|||||:.|||:::|||:||:.|...||:|:..|..|.|.:|::..:||.|:.|::.
Human   502 FTRLSSSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRH 566

  Fly   480 TCLGHLPLTCQFSVVEVELQPPVVTGGILKLFKEDILHRKKERQRRDREERKREQHINEINDRQM 544
            ..|.||||||:||:.|:.||||||:...|::|.:||..||::||::.||||:||:.|....:::.
Human   567 RYLSHLPLTCEFSICELALQPPVVSKETLEMFSDDIEKRKRQRQKKAREERRRERRIEIEENKKQ 631

  Fly   545 GKLIASAANLDLSSSHEFP-----TCGFEEALPAPS----GSVPMNISNQDPGSRYS-------- 592
            ||.  ...::.|.:..:||     ||..:.||...|    |::.::..::.|||...        
Human   632 GKY--PEVHIPLENLQQFPAFNSYTCSSDSALGPTSTEGHGALSISPLSRSPGSHADFLLTPLSP 694

  Fly   593 SVTLGSPKQEMWPTIGS---NSPGGGGAPLDVQVG-----AWGRSAPPPPRAVMVPRTS-DEDFE 648
            :.:.|||..    .:||   :||....|.: ::||     .|.::||......:||... |.|.|
Human   695 TASQGSPSF----CVGSLEEDSPFPSFAQM-LRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGE 754

  Fly   649 ------------QRSVGHWGLGELLVGALDQKKQKVGAAKSNGAAPA------ESKKQKKAKGKK 695
                        |.|.                .|.:.||......||      |.|..||.|.:|
Human   755 SDNSDRVPVPSFQNSF----------------SQAIEAAFMKLDTPATSDPLSEEKGGKKRKKQK 803

  Fly   696 MVPLFATGM 704
            ...||:|.:
Human   804 QKLLFSTSV 812

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 33/41 (80%)
RNF10NP_001317403.1 Interaction with MEOX2. {ECO:0000269|PubMed:16335786} 101..185 32/102 (31%)
zf-C3HC4_2 225..266 CDD:290634 33/41 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C364759956
eggNOG 1 0.900 E1_KOG2164
Hieranoid 1 1.000
Homologene 1 1.000 H40990
Inparanoid 1 1.050 316 1.000 Inparanoid score I2509
Isobase 1 0.950 0 Normalized mean entropy S5724
OMA 1 1.010
OrthoDB 1 1.010 D1373540at2759
OrthoFinder 1 1.000 FOG0004207
OrthoInspector 1 1.000 T1075270
orthoMCL 1 0.900 OOG5_127918
Panther 1 1.100 LDO PTHR12983
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1987
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.