DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12099 and rnf10

Sequence 1:NP_647623.1 Gene:CG12099 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_001116727.1 Gene:rnf10 ZFINID:ZDB-GENE-030131-2969 Length:778 Species:Danio rerio

Alignment Length:820 Identity:271/821 (33%)
Similarity:373/821 (45%) Gaps:186/821 (23%)


  Fly     3 SNNSSNSKKQPQSSHHG---KSSSAESQRKSSELHTNSNKQRHSRRR-------NQVPTPRNDQQ 57
            :||||::|..|:||..|   ..|.|::..|:     |...:|:||:|       ...|.||..|.
Zfish    23 NNNSSSTKIPPRSSSTGLNPTDSKAKTDGKN-----NGGSKRYSRKREPTFAKAESFPGPRRSQP 82

  Fly    58 QQPQQPAKLRPNVDKRPKARGFGGGYDFPSPRGQDGASGSSRLAYSATGYSRSGDFDHELNSVYT 122
            |:       ..|.||||..|| |.|.      .|.|.:|..|....|.  :|..:|    :....
Zfish    83 QK-------NKNFDKRPPQRG-GAGV------RQYGLAGGGRREEVAE--NRRAEF----SPAQF 127

  Fly   123 QGSKKQNLNHLLNFHCVPRELERGHHHQAQQHHGLSGRKQR-------YNKEQFLQANFQFVIRS 180
            .|.||.:|||||||...||   .||.......|...||:.:       :|||.|||||.|||:..
Zfish   128 AGPKKISLNHLLNFTFEPR---GGHFGSGGDGHSCWGRRNKWGHKHKPFNKELFLQANCQFVVSD 189

  Fly   181 GAKAQVN-GSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLSLSD 244
            ....|.: ..||.|:||..::|:.|.:.|...|||||||||||.:|||||.|||||:|||||||:
Zfish   190 DQDYQAHFTDPDTLVDWDCVQQVRIYSHEVPSCPICLYPPVAAHMTRCGHIYCWPCMLHYLSLSE 254

  Fly   245 KTWRKCPICYDAIHAGDLKSCTIEQLRDLQVGEKITFQLMRRRKGSMYIENHVAGLGETIERFPF 309
            |:|.||||||:|:|:.||||....:.|....|..||..||||.|||:.          .:....:
Zfish   255 KSWSKCPICYEAVHSADLKSVVAMETRQYVSGNSITMCLMRREKGSLV----------ALPSSQW 309

  Fly   310 VSAGEEAK-------RYSKFLIAKRMDVAAIIERER----NELLAESDVSCPEDVFIQQALVMLQ 363
            |...|..:       .|||.|:|.|..|..::..||    .:|..|.|  .|:..|||.||:.||
Zfish   310 VKVEEPIQFGDVQFCSYSKLLLASRQQVLGLLAEERMALQTQLSQEKD--DPQACFIQSALLQLQ 372

  Fly   364 ERVEKL-------------GV--------EKPDPK--------------------EDEEETAPVL 387
            ||.|.|             ||        |:..|:                    :||.:.|...
Zfish   373 EREESLLKRRRRKTAGSVDGVDMRKLSLSEQSSPEVTVVNNLTNSKPILQYASAFDDEVQDAQEE 437

  Fly   388 CLETETKIDIEKSDDASISSG-------EASSSLSYSSNHNKYYYFYQSNDGQNIYLHPLNVKML 445
            .||..|...:.::.: .|..|       |.:...|.:::|..||||||:.|||.::|||:||:.|
Zfish   438 VLEEMTNPSVHEAPE-EIPDGDVEDLPVEETPQSSQTAHHGPYYYFYQAEDGQQMFLHPVNVRCL 501

  Fly   446 QACYGTLDLGPLLIEAQIVQMEQHSMDEEHRRKFTCLGHLPLTCQFSVVEVELQPPVVTGGILKL 510
            |..||:|:..|..|.|.:|:::..::.|:.||:...|.||||||:||:.|::||||:::...|..
Zfish   502 QRQYGSLENSPQTITANVVEIDGQTVTEDIRRRHRYLSHLPLTCEFSLCELDLQPPILSKETLDS 566

  Fly   511 FKEDILHRKKERQRRDREERKREQHINEINDRQMGKLIASAANLDLSSSHEFPTCGFEEALPAPS 575
            |.:||..||:.||::.|:|::||:.|....:|:.||.  ...::.|.:.|.||.          .
Zfish   567 FADDIEKRKRLRQKKVRDEKRREKRIEMEENRKQGKY--PEVHIGLENLHHFPA----------F 619

  Fly   576 GSVPMNISNQDPGSRYSSVTLG-------SPKQE--MWPTIGSNSPG------------------ 613
            ||.|.|    .|......|.||       ||..:  |:|.:..:||.                  
Zfish   620 GSPPQN----GPQLHLPEVLLGPPSPLSSSPSSDGVMFPNLSEHSPSLSVVGVEEDSHCMSFAQM 680

  Fly   614 --GGGAPLDVQVGAWGRSAPPPPRAVMVPRTSDEDFE------------QRSVGHWGLGELLVGA 664
              ||.|.:|    ...::.|......:.|..:|.|.|            |.|... .||:.| ..
Zfish   681 LKGGKARVD----TGPKTTPKKADMFLAPPAADSDGESDNSDRVPVPSFQNSFSQ-ALGQAL-SK 739

  Fly   665 LDQKKQKVGAAKSNGAAPAESKKQKKAKGKKMVPLFATGM 704
            ||...|....     |.|....|..|.|.||...||:|.|
Zfish   740 LDNGNQTPAP-----ALPISDDKGGKKKKKKQKLLFSTSM 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 34/41 (83%)
rnf10NP_001116727.1 zf-C3HC4_2 222..263 CDD:290634 34/41 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C364760141
eggNOG 1 0.900 E1_KOG2164
Hieranoid 1 1.000
Homologene 1 1.000 H40990
Inparanoid 1 1.050 342 1.000 Inparanoid score I2278
OMA 1 1.010
OrthoDB 1 1.010 D1373540at2759
OrthoFinder 1 1.000 FOG0004207
OrthoInspector 1 1.000 T1054522
orthoMCL 1 0.900 OOG5_127918
Panther 1 1.100 LDO PTHR12983
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1987
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.