DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12099 and rnf10

Sequence 1:NP_647623.1 Gene:CG12099 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:XP_012814046.1 Gene:rnf10 XenbaseID:XB-GENE-854662 Length:754 Species:Xenopus tropicalis

Alignment Length:815 Identity:259/816 (32%)
Similarity:372/816 (46%) Gaps:187/816 (23%)


  Fly     1 MDSNNSSNSKKQPQSSHHGKSSSAESQRKSSELHTNSNKQRHSRRRNQVPTPRNDQ---QQQPQQ 62
            ||..:::.:|.|.:|...|  .|.||:.||...:.||:|||::|:|.. ..|:|:.   |.:...
 Frog    12 MDPGSANANKNQNRSGSAG--PSGESKPKSEPKNGNSSKQRYNRKREN-SYPKNETFAGQSRRSC 73

  Fly    63 PAKLRPNVDKRPKARGFGGGYDFPSPRGQDGASGSSRLAYSATGYSRSGDFDHELNSVYTQGSKK 127
            |.|.: ..:|.|..|  ||...:...|.::.|. :.|..:|:..||               |.||
 Frog    74 PQKSK-TFNKVPPQR--GGPKQYGMGRREEVAE-TQRAEFSSAQYS---------------GPKK 119

  Fly   128 QNLNHLLNFHCVPRELERGHHHQAQQHHGLSGRKQR-----YNKEQFLQANFQFVIRSGAKAQVN 187
            .||||||||...||     .|......:|..||:.:     :|||.|||||.|||:.......|:
 Frog   120 INLNHLLNFTFEPR-----GHPGGLNGNGNFGRRHKWGNKPFNKELFLQANCQFVVSDDNDYSVH 179

  Fly   188 -GSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLSLSDKTWRKCP 251
             ..||.|:.|.::||:.|.:.|...||||||||||||:|||||.:||.|:|||||||:|.|.:||
 Frog   180 FADPDTLVSWDFVEQVRIFSHEVPSCPICLYPPVAAKITRCGHIFCWACILHYLSLSEKDWSRCP 244

  Fly   252 ICYDAIHAGDLKSCTIEQLRDLQVGEKITFQLMRRRKGS---------MYIEN--HVAGLGETIE 305
            |||.::...||||....:.....||:|||.|||||.||.         |.::.  |:..|..|: 
 Frog   245 ICYSSVIKKDLKSVVTTETHLYSVGDKITMQLMRREKGVLVAMPKSKWMKLDEPIHLGDLDHTL- 308

  Fly   306 RFPFVSAGEEAKRYSKFLIAKRMDV-AAIIERERNELLAE--SDVSCPEDVFIQQALVMLQER-- 365
                         |||.|:|.|..: :.:|..|:..||.:  ::...||..||:.|:..||:|  
 Frog   309 -------------YSKLLLASRDQILSQVIGEEKVALLEQYNAEKETPEACFIEAAMQELQDRAG 360

  Fly   366 ----------------VEKLGVEKPDPKED--------------EEETAPVLCLE---TETK--- 394
                            :|.|..|....|:.              ||||....|.:   ||:.   
 Frog   361 NLCAASKPEIEAATLSMEALNFESTSDKQHTVLEREVVHYISAFEEETMEPPCEDCSPTESSPPD 425

  Fly   395 ------IDIEKSDDA---SISSGEASSSLSYSSNHNKYYYFYQSNDGQNIYLHPLNVKMLQACYG 450
                  .|:..:.|.   |:|..|:.........::.||||||:.|||::||||:||:.|...||
 Frog   426 ITAVLATDVSTATDGGLPSLSQQESKPENCGPLGNSHYYYFYQAVDGQHVYLHPVNVRCLVHEYG 490

  Fly   451 TLDLGPLLIEAQIVQMEQHSMDEEHRRKFTCLGHLPLTCQFSVVEVELQPPVVTGGILKLFKEDI 515
            :|:..|..|.|.:|:|:..:|.||.||:...|.||||||:||:.|:.|.||.|:...|:||..::
 Frog   491 SLERCPEKITATVVEMDGFTMTEEVRRRHRYLCHLPLTCEFSICEMALGPPDVSVDTLELFTAEV 555

  Fly   516 LHRKKERQRRDREERKREQHINEINDRQMGKLIASAANLDLSSSHEFP--------------TCG 566
            ..||:.|||:.|:|::||:.|....:::.|  |...|.:.|.:..:||              |..
 Frog   556 EKRKRLRQRKARDEQRREKRIELEENKKQG--IYPEARIALENLQQFPAFSSSPIDSLFNVETQN 618

  Fly   567 FEEALP------APSGSVPMNISNQDP-----GSRYSS----VTLGSPKQEMWPTIGSNSPGGGG 616
            |....|      :.|||:.....:.||     .||..|    :.:|..|.|.||.         .
 Frog   619 FISVSPLSCSPTSQSGSLLGAECSSDPLLTEDESRCPSFAQMLRVGKAKPETWPK---------A 674

  Fly   617 APLDVQVGAWGRSAPPPPRAVMVPRTSDEDFE------------QRSVGHWGLGELLVGALDQKK 669
            ||.:|            |...:.|..:|.|.|            |.|...         |::...
 Frog   675 APKNV------------PENTLTPANADSDVESDCSERVPVPSFQNSFSQ---------AMEAAF 718

  Fly   670 QKVGAAKSNGAAPAESKKQKKAKGKKMVPLFATGM 704
            .|:.||.   ..|...:|..|.|.|:...||:|.:
 Frog   719 LKLDAAL---PTPPSVEKGGKKKKKQQKLLFSTSI 750

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 32/41 (78%)
rnf10XP_012814046.1 zf-C3HC4_2 205..246 CDD:290634 32/41 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C364764981
eggNOG 1 0.900 E1_KOG2164
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H40990
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1373540at2759
OrthoFinder 1 1.000 FOG0004207
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.