DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12099 and Rnf10

Sequence 1:NP_647623.1 Gene:CG12099 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:XP_006249496.1 Gene:Rnf10 RGDID:1309282 Length:803 Species:Rattus norvegicus

Alignment Length:833 Identity:262/834 (31%)
Similarity:391/834 (47%) Gaps:177/834 (21%)


  Fly     1 MDSNNSSNSKKQPQSSHHG----KSSSA----ESQRKSSELHTNSNKQRHSRRRNQVPTPRNDQQ 57
            ||.|:.|||......|..|    :|:||    ||:.||...::|.:|:.:.:|....|...|...
  Rat    15 MDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSNGSKRYNRKREPSYPKNENFSN 79

  Fly    58 QQPQQPAKLRPNVDKRPKARGFGGGYDFPSPRG---QDGASGSSRLAYSATGYSRSGDFDHELNS 119
            |..:..::.....:|.|..||.|....|.|...   :|..:.:.|..:|...:|           
  Rat    80 QSRRSNSQKSKTFNKTPPQRGGGSSKPFSSSSNGGRRDEVAEAQRAEFSPAQFS----------- 133

  Fly   120 VYTQGSKKQNLNHLLNFHCVPRELERGHHHQAQQHHGLSGRKQR-----YNKEQFLQANFQFVIR 179
                |.||.||||||||...||. :.||...:  .||..|::.:     :|||.|||||.|||:.
  Rat   134 ----GPKKINLNHLLNFTFEPRG-QAGHFEGS--GHGSWGKRNKWGHKPFNKELFLQANCQFVVS 191

  Fly   180 SGAKAQVN-GSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLSLS 243
            .......| ..||.|::|.::||:.|.:.|...||||||||.|||:|||||.:||.|:|||||||
  Rat   192 EDQDYTANFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSLS 256

  Fly   244 DKTWRKCPICYDAIHAGDLKSCTIEQLRDLQVGEKITFQLMRRRKG-------SMYIE-NHVAGL 300
            ::||.||||||.::|..||||....:.|...||:.||.|||:|.||       |.::. :|...|
  Rat   257 ERTWSKCPICYSSVHKKDLKSVVATESRQYVVGDTITMQLMKREKGVLVALPKSKWMNVDHPISL 321

  Fly   301 GETIERFPFVSAGEEAKRYSKFLIAKRMDV--AAIIERE--RNELLAESDVSCPEDVFIQQAL-- 359
            |:           |:..:|||.|:|.:..|  ..::|.:  ..:.||| :...||..||:.||  
  Rat   322 GD-----------EQHSQYSKLLLASKEQVLHRVVLEEKVALEQQLAE-EKHTPESCFIEAALQE 374

  Fly   360 VMLQER------------------VEKLGVEKPDPKED---------------EEETAPVLCL-- 389
            |.::|.                  :|:|.:..|..||.               :||.|.|..|  
  Rat   375 VKIREEALSGVAGGRAEVTGVVTALEQLVLMAPLAKESAFQPRKGVLEYLSAFDEEAAQVCSLDP 439

  Fly   390 ----------ETETKIDIEKSDDA----SISSGEASSSLSYSS----------NHNKYYYFYQSN 430
                      |.|...:.|..:|.    |:..|...:.||...          :.:..|||||:.
  Rat   440 PGPLALPLVEEEEAVSEPEACEDLIADDSLGEGTVCAELSQEEPIAKPGFTQLSSSPCYYFYQAE 504

  Fly   431 DGQNIYLHPLNVKMLQACYGTLDLGPLLIEAQIVQMEQHSMDEEHRRKFTCLGHLPLTCQFSVVE 495
            |||:::|||:||:.|...||:|:..|..|.|.:|::..:||.|:.|::...|.||||||:||:.|
  Rat   505 DGQHMFLHPVNVRCLVREYGSLEQSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICE 569

  Fly   496 VELQPPVVTGGILKLFKEDILHRKKERQRRDREERKREQHINEINDRQMGKLIASAANLDLSSSH 560
            :.||||||:...|::|.:||..||::||::.||||:||:.|....:::.|:.  ...::.|.:..
  Rat   570 LALQPPVVSKETLEMFSDDIEKRKRQRQKKAREERRRERRIELEENKRQGRY--PEVHIPLENLQ 632

  Fly   561 EFP-----TCGFEEALPAPS----GSVPMNISNQDPGSRYS--------SVTLGSPKQEMWPTIG 608
            :||     ||..:.||...|    |::.::..::.|||...        :.:.|||..    .:|
  Rat   633 QFPAFNSYTCSSDSALGPTSTEGHGALSLSPLSRSPGSHADFLLTPLSPTASQGSPSF----CVG 693

  Fly   609 S---NSPGGGGAPLDVQVG-----AWGRSAP-------PPPRAVMVPRTSDEDFEQRSVGHWGLG 658
            |   :||....|.: ::||     .|.::||       .||..|      |.|.|..:     ..
  Rat   694 SLEEDSPFLSFAQM-LRVGKAKADGWPKAAPKKDDNSLAPPAPV------DSDGESDN-----SD 746

  Fly   659 ELLVGALDQK-KQKVGAAKSNGAAPA------ESKKQKKAKGKKMVPLFATGM 704
            .:.|.:.... .|.:.||......||      |.:..:|.|.:|...||:|.:
  Rat   747 RVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSEDRGGRKRKRQKQKLLFSTSV 799

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 32/41 (78%)
Rnf10XP_006249496.1 zf-C3HC4_2 225..266 CDD:290634 32/41 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C364762332
eggNOG 1 0.900 E1_KOG2164
Hieranoid 1 1.000
Homologene 1 1.000 H40990
Inparanoid 1 1.050 323 1.000 Inparanoid score I2380
OMA 1 1.010
OrthoDB 1 1.010 D1373540at2759
OrthoFinder 1 1.000 FOG0004207
OrthoInspector 1 1.000 T1088924
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12983
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.