DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12099 and SPBP8B7.23

Sequence 1:NP_647623.1 Gene:CG12099 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_596530.1 Gene:SPBP8B7.23 PomBaseID:SPBP8B7.23 Length:673 Species:Schizosaccharomyces pombe

Alignment Length:771 Identity:178/772 (23%)
Similarity:320/772 (41%) Gaps:181/772 (23%)


  Fly     1 MDSNNSSNSKKQPQSSHHGKSSS--AESQRKSSELHTNSNKQRHSRRRNQVPTPRNDQQQQPQQP 63
            |.||::|:||...:|.:...|||  ..|..|:.|...:....|:|.::.|....:|.|....::.
pombe    12 MPSNSNSSSKLNAKSPNFIPSSSNIPRSSAKTKEHSADRKPHRNSEKKTQGMPRKNQQLASSERK 76

  Fly    64 AKLRPNVDKRPKARGFGGGYDFPSPRGQDGASGSSRLAYSATGYSRSGDFDHELNSVYTQGSKKQ 128
            .|.:..::|:..|.....|.....|:               |.|      |..|..:.:..:.|:
pombe    77 TKNKKRLEKQSSAIADSIGESLDDPQ---------------TVY------DEHLFDILSARTNKR 120

  Fly   129 ---NLNHLLNFHCVPR----------ELERGH--HHQAQQHHGLSGRKQRYNKEQFLQANFQFVI 178
               ||||||||...||          ...||:  :.|...||.:       :|.:::.||::||:
pombe   121 GQINLNHLLNFQFTPRTNSNAFSAPPRRSRGYNTYGQGSGHHPM-------DKSRYVNANYRFVV 178

  Fly   179 RS-GAKAQVNGSPDALIDWSYIEQINIQTTEEL-QCPICL-YPPVAAKLTRCGHAYCWPCLLHYL 240
            .. |........||:.:.|..:.|:...:..:| .||.|| ..||||:::||||.||:.|||.::
pombe   179 SPIGDYQSQKLDPDSPVKWEDVWQVLCSSDFQLAACPFCLEEKPVAARMSRCGHVYCFSCLLRFV 243

  Fly   241 SLSDKT----------------WRKCPICYDAIHAGD---LKSCTIEQLRDLQVGEKITFQLMRR 286
            ......                .|.||||:|:|...|   ::....::.:.|:.|:.:..:|.:|
pombe   244 ETPTAAEVKAAETSGTKIVKCGHRSCPICWDSIRLRDVHPIRWVEDKEFQKLEEGKSVCLRLYQR 308

  Fly   287 RKGSMYIENHVAGLGETIERFP-------------------FVSAGEEAKRYSKFLIAKR--MDV 330
            ..||             |..||                   |..:|   ..|::.:|...  |..
pombe   309 NNGS-------------ILAFPRSCRSFALDGSFHSDEIPNFTMSG---AAYARIIIGSHDYMVQ 357

  Fly   331 AAIIERERNELLAESDVSC--PEDVFIQQALVMLQERVEKL--GVEKPDPKEDEEETAPVLCLET 391
            ..::|.|:.:.:|..|:|.  ..|.:.::...:|.:|:..|  .|.:.:.|..:.: ...|||::
pombe   358 QHLLEIEQLQQIAAEDISLYGSADTYYERITQILLDRISSLSESVNEQNIKSLQTD-IDNLCLQS 421

  Fly   392 ETKIDIEKSDDAS-ISSGEASSSLSYSSNHNKYYYFYQSNDGQNIYLHPLNVKMLQACYGTLDLG 455
            .:...:.:.||.: :|..|.:.:          |.|||.....:|||.||::::|::.:|:.:..
pombe   422 NSLKQLSEVDDLNDVSGSEIADA----------YLFYQPFAHSHIYLSPLDIRILKSAFGSYENF 476

  Fly   456 PLLIEAQIVQMEQ-HSMDEEHRRKFTCLGHLPLTCQFSVVEVELQPPVVTGGILKLFKEDILHRK 519
            |..:..::.::.. |.::.|.|::|..:.|||..|:.:.:|.:.. .::...:|..||.:|..|:
pombe   477 PDELVPRVERISSGHLVNSELRQRFKYMAHLPEGCEVAFIECDWS-KIIPKEVLLTFKSEISKRR 540

  Fly   520 KERQRRD-REERKREQHINEINDRQMGKLIASAANLDLSSSHEFPTCGFEEALPAPSGSVPMNIS 583
            |:|:.:: ||||.|::     .:|...:.|.|..|:                    ...||..:.
pombe   541 KQRKAQEMREERYRQR-----AERDTEEQIYSELNM--------------------QRPVPKTVV 580

  Fly   584 NQDPGSRYSSVTLGSPKQ-EMWPTIGSNSPGGGGAPLDVQVGAWGRSAPPPPRAVMVPRTSDEDF 647
            ::||...:.  ||||..| |....:.::.     :.|......||..|       :....:|.| 
pombe   581 HEDPAEAFP--TLGSHHQFESTDEVNTDE-----STLSTAKTVWGTRA-------LANIQNDTD- 630

  Fly   648 EQRSVGHWGLGELLVGALDQKKQKVGAAKSNGAAPAESKKQKKAKGKKMVPLFATG 703
            :|..:..|.:....|..|              :||:::.|.||   ||.:.|.:||
pombe   631 DQDDLDGWKVDWDKVAQL--------------SAPSKNSKNKK---KKKLVLLSTG 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 21/58 (36%)
SPBP8B7.23NP_596530.1 RING 214..272 CDD:214546 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I1277
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004207
OrthoInspector 1 1.000 T1125852
orthoMCL 1 0.900 OOG5_127918
Panther 1 1.100 LDO PTHR12983
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1987
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.