DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12099 and T13A10.2

Sequence 1:NP_647623.1 Gene:CG12099 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_500945.1 Gene:T13A10.2 WormBaseID:WBGene00020469 Length:161 Species:Caenorhabditis elegans

Alignment Length:47 Identity:15/48 (31%)
Similarity:19/48 (40%) Gaps:6/48 (13%)


  Fly   212 CPIC--LYP---PVAAKLTRCGHAYCWPCLLHYLSLSDKTWRKCPIC 253
            |.:|  .|.   |...|:..|.|.||..| :..:|.......|||.|
 Worm    97 CAVCHDSYASRGPKKPKVCSCLHTYCGAC-IREISSRHNGEMKCPEC 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 14/46 (30%)
T13A10.2NP_500945.1 DivIC <25..>73 CDD:299713
RING 97..142 CDD:214546 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373540at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.