DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and stag1a

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001349269.1 Gene:stag1a / 564533 ZFINID:ZDB-GENE-070912-448 Length:1258 Species:Danio rerio

Alignment Length:1098 Identity:251/1099 (23%)
Similarity:462/1099 (42%) Gaps:199/1099 (18%)


  Fly    10 VLNDSQASNQMDFEIREECSIAPNDEPVCVDGTV---------GDATNKSLLQMILSRKRLSPTN 65
            ||.|:..|.|....:  ..|::..|:|  .||.:         ..|.||        :.|.||:.
Zfish     8 VLQDTGDSGQDTVSL--SMSMSELDDP--GDGKIKKKRGRPGRPPAANK--------KPRKSPSE 60

  Fly    66 K--------------------------------RNSHIESVAKYWGEFYLDSPTAALVALLQFVV 98
            |                                ..|.::||...|.|.|......||:.|:.|.:
Zfish    61 KGFMAVQRGRKANGISQQNGEGDPVTLFEVVKQGKSAMQSVVDDWIESYKQDRDLALLDLINFFI 125

  Fly    99 EVSGSHYQIPDDTSMPFSYSDILSNSSSHF-SNTHIYPL-IRKPA-DVFVNQVGSFLNALL---- 156
            :.||....:..:.......::|:...:..| .::..||| |..|. ..|......|:..|:    
Zfish   126 QCSGCKGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTISGPLWKKFRYNFCEFICVLIRQCQ 190

  Fly   157 --LVANKFRSDSYQLFLVQLTNFVMACSESNIRTFRHTATMIGLKIMTIL--------------- 204
              ::.:::..|:       :.:.:...|:|.:|.||||:|:..:|:||.|               
Zfish   191 YSIIYDEYMMDT-------VISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSINQDNTQ 248

  Fly   205 --------------------------SDLKSLDDEIAMTVWMQMFNSMFVARSRDIVTDIRLLCI 243
                                      .:|:...|||. .:...:|..:||.|.||.:.:||.:||
Zfish   249 RQYEAERSKIVGKRATEKLELLLQKRKELQENQDEIE-NMMNSIFKGIFVHRYRDAIAEIRAICI 312

  Fly   244 SELGQWFARYPHCHLQPTSLRIFYEALNDGSGDV-IQCSLDNISVLCRKDVLFSEIVALTSEFRE 307
            .|:|.|...|....|..:.|:.....|:|..|:| ::| |..:..|.....||.::...|:.|::
Zfish   313 EEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKC-LKALQNLYTNRELFPKLELFTNRFKD 376

  Fly   308 ILVELCLGKEDAIAEKSVQFLTHFHVLSAEILTDDVCRVLEQLIMAANRGLAQAAADL----FIL 368
            .:|.:.|.||..:|.::::.:|.....|.:.|:::.|..:..|:.:|:|.:|.||.:.    ...
Zfish   377 RIVSMTLDKEYDVAVEAIRLVTLILQGSEDALSNEDCENVYHLVYSAHRPVAVAAGEFLHRKLFS 441

  Fly   369 RRNGLDGETFCQR----------VKHLLQLFIECG-HEQADYLVDSLIDNC-ELVLDWKSMIAVL 421
            |.:....|...:|          ::.|:..|:|.. ||.|.||||||.::. ||:.||:.|..:|
Zfish   442 RHDPQAEEALAKRRGRSSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELL 506

  Fly   422 LENPKSRE--LSDIHCSSLIAILLAGVKQATAGEIPPGRYT-----KDLKREPRQGAQERATKCL 479
            ||.|...|  |:|...||||.:.:..::||.....|.||.|     ...:|:.:...:.:.|:..
Zfish   507 LEEPVQGEEVLADRQESSLIELTVCTIRQAAEAHPPVGRGTGKRVLTAKERKMQIDDKNKLTEHF 571

  Fly   480 APVLPELLRTYANRLQDIERLLELPKYFCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQI 544
            ...||.||..|....:.:..||::|:||..|.|........|:.|::..:.:: ::.:.|.||:.
Zfish   572 IMALPMLLSKYQTDSEKVANLLQIPQYFDLDVYSAGRMEKHLDALLKQIKFVV-EKHTDTEVLEA 635

  Fly   545 TVKTLEFL--------NRMIPIPLTK-QLLNSAVTNYKMAWHRTQD--TSPSRSTHNESNRLLAT 598
            ..||...|        ||   :.:.: ||::.....:.   |..::  .:...:..::...:|:|
Zfish   636 CSKTYSILCSEEYTIMNR---VDIARSQLIDELADRFN---HSVEELLQAGEEADDDDIYNVLST 694

  Fly   599 LRLLTVLSGHFNLSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKACFCCLCWDMENLE 663
            |:.||......:|::||........|:..:.|..:|  :.:..:|    |:.....:.|.:..:.
Zfish   695 LKRLTAFHNAHDLTRWDFFGNCYRLLRTGIEQGSMP--EQIAVQA----LQCSHYSILWQLVKIT 753

  Fly   664 GTALNNVDMDEYCDVLHHNLEDYLYVTFSLVGKSNTEPLAYPCFSYTCDLFVLHGN-LCGSSNPS 727
            ..|.:..|:    ..|...::.:|.:....:...|| |:....|...|||.::..: |...|...
Zfish   754 EGAPSKDDL----LALRRVVKSFLAICQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLTTGSREG 813

  Fly   728 IRSVAHVPSGNELDILEGFLMEH-FLELSPSDLMLETNSDQ-------LQRIRSILTSYLKVVCL 784
            ::.:..:|.|...:.|..|:::| |::....:..:|.:.:.       |.:.|::|.::.|::..
Zfish   814 LQPLVFIPDGTLQNELLNFILDHVFIDQDDENQSIEGDEEDEANKIEALHKRRNLLAAFSKLIIY 878

  Fly   785 GVVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVFPDD----- 844
            .::....|:..:::|:||:..:||:::.::....|.:.|..|.|::.:...|:.::..|.     
Zfish   879 DIIDMPAAADIFKHYMKYYNDYGDIIKETLSKTRQTDKILCAKTLILSLQQLFNELIQDQGPNLD 943

  Fly   845 --TRHAAGQRALRPAEFSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELAQKQPTE-A 906
              :.|.:|           :.|||.|.|.....:.::.||.|..||:.||.|.|:....:..| .
Zfish   944 RTSSHVSG-----------IKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNPKGAEYP 997

  Fly   907 TKKLPFLRVLKVFVPLLLVQDKTRILNFFEPY--EQLIIPTCNRNDI-AHLKEYRNAL 961
            ...|.||.||..|...||.|||..:..:.|.:  ||::.   .|.|| ..|..|||:|
Zfish   998 PPNLAFLEVLCEFSSKLLRQDKKTVHAYLEKFMTEQMME---RREDIWLPLISYRNSL 1052

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 25/132 (19%)
stag1aNP_001349269.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62829388
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.