powered by:
Protein Alignment SA-2 and TRIM74
DIOPT Version :9
| Sequence 1: | NP_612109.3 |
Gene: | SA-2 / 38167 |
FlyBaseID: | FBgn0043865 |
Length: | 973 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001304744.1 |
Gene: | TRIM74 / 378108 |
HGNCID: | 17453 |
Length: | 250 |
Species: | Homo sapiens |
| Alignment Length: | 114 |
Identity: | 28/114 - (24%) |
| Similarity: | 44/114 - (38%) |
Gaps: | 35/114 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 377 TFCQRVK-HLLQLFIECGHEQ--ADYLVDSLIDNCELVLDWKSMIAVLL-----------ENPKS 427
|.|.|:| .|..||.|...|| .|.|:..|:.|...:::...:.:.:: :..|:
Human 127 TVCSRMKEELAALFSELKQEQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRHPVDEEKA 191
Fly 428 RELSDI--HCSSLIAILLAGVKQATAGEIPPGRYTKDLKREPRQGAQER 474
|.|..| |...|:|.| |::.|..||.:||
Human 192 RCLEGIGGHTRGLVASL-------------------DMQLEQAQGTRER 221
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| SA-2 | NP_612109.3 |
STAG |
134..217 |
CDD:285686 |
|
| TRIM74 | NP_001304744.1 |
RING |
15..60 |
CDD:238093 |
|
| BBOX |
90..125 |
CDD:237988 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D167826at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.