DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and Stag1

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_006243693.1 Gene:Stag1 / 315958 RGDID:1310744 Length:1258 Species:Rattus norvegicus

Alignment Length:1003 Identity:238/1004 (24%)
Similarity:438/1004 (44%) Gaps:156/1004 (16%)


  Fly    69 SHIESVAKYWGEFYLDSPTAALVALLQFVVEVSGSHYQIPDDTSMPFSYSDILSNSSSHF-SNTH 132
            |.::||...|.|.|......||:.|:.|.::.||....:..:.......::|:...:..| .::.
  Rat    96 SAMQSVVDDWIESYKQDRDIALLDLINFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSG 160

  Fly   133 IYPLI------RKPADVFVNQVGSFLNALL------LVANKFRSDSYQLFLVQLTNFVMACSESN 185
            .|||.      :|    |.:....|:..|:      ::.:::..|:       :.:.:...|:|.
  Rat   161 DYPLTMPGPQWKK----FRSNFCEFIGVLIRQCQYSIIYDEYMMDT-------VISLLTGLSDSQ 214

  Fly   186 IRTFRHTATMIGLKIMTIL-----------------------------------------SDLKS 209
            :|.||||:|:..:|:||.|                                         .:|:.
  Rat   215 VRAFRHTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQE 279

  Fly   210 LDDEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQWFARYPHCHLQPTSLRIFYEALNDGS 274
            ..|||. .:...:|..:||.|.||.:.:||.:||.|:|.|...|....|..:.|:.....|:|..
  Rat   280 NQDEIE-NMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQ 343

  Fly   275 GDV-IQCSLDNISVLCRKDVLFSEIVALTSEFREILVELCLGKEDAIAEKSVQFLTHFHVLSAEI 338
            |:| ::| |..:..|.....||.::...|:.|::.:|.:.|.||..:|.::::.:|.....|.|.
  Rat   344 GEVRLKC-LKALQSLYTNRELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEA 407

  Fly   339 LTDDVCRVLEQLIMAANRGLAQAAADLFILR------------------RNGLDGETFCQRVKHL 385
            |:::.|..:..|:.:|:|.:|.||.:....:                  ||..:|..    ::.|
  Rat   408 LSNEDCENVYHLVYSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNL----IRML 468

  Fly   386 LQLFIECG-HEQADYLVDSLIDNC-ELVLDWKSMIAVLLENPKSRE--LSDIHCSSLIAILLAGV 446
            :..|:|.. ||.|.||||||.::. ||:.||:.|..:|||.|...|  :||...|:||.:::..:
  Rat   469 VLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTI 533

  Fly   447 KQATAGEIPPGRYT-----KDLKREPRQGAQERATKCLAPVLPELLRTYANRLQDIERLLELPKY 506
            :||.....|.||.|     ...:|:.:...:.:.|:.....||.||..|:...:.:..||::|:|
  Rat   534 RQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQY 598

  Fly   507 FCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQITVKTLEFL--------NRMIPIPLTK- 562
            |..:.|........|:.|::..:.:: ::...:.||:...||...|        ||   :.:.: 
  Rat   599 FDLEIYSTGRMEKHLDALLKQIKFVV-EKHVESDVLEACSKTYSILCSEEYTIQNR---VDIARS 659

  Fly   563 QLLNSAVTNYKMAWHRTQD--TSPSRSTHNESNRLLATLRLLTVLSGHFNLSKWDLTEPLLFSLK 625
            ||::..|..:.   |..:|  .....:..::...:|:||:.||......:|:||||.......||
  Rat   660 QLIDEFVDRFN---HSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLLK 721

  Fly   626 MLLRQRRLPNGDDLPPEAFSLYLKACFC---CLCWDMENLEGTALNNVDMDEYCDVLHHNLEDYL 687
            ..:....:|.         .:.::|..|   .:.|.:..:...:.:..|:    .||...::.:|
  Rat   722 TGIEHGAMPE---------QIVVQALQCSHYSILWQLVKITDGSPSKEDL----LVLRKTVKSFL 773

  Fly   688 YVTFSLVGKSNTEPLAYPCFSYTCDLFVL--HGNLCGSSNPSIRSVAHVPSGNELDILEGFLMEH 750
            .|....:...|| |:....|...|||.::  |..:.|........|.:..:|.:.::| .|:|:|
  Rat   774 AVCQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELL-SFVMDH 836

  Fly   751 -FLELSPSDLMLETNSDQ-------LQRIRSILTSYLKVVCLGVVPTMRASKFYEYYVKYHAPFG 807
             |::....:..:|.:.:.       |.:.|::|.::.|::...:|....|:..:::|:||:..:|
  Rat   837 VFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDYG 901

  Fly   808 DVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVFPDDTRHAAGQRALRPAEFSELMELANRLAKI 872
            |:::.::....|.:.|..|.|:    :|...::|.:..:..........|..|.:.|||.|.|..
  Rat   902 DIIKETLSKTRQIDKIQCAKTL----ILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALT 962

  Fly   873 LISNPMEHRECVIALHRSGILFVFELA-QKQPTEATKKLPFLRVLKVFVPLLLVQDKTRILNFFE 936
            ...:.::.||.|..||:.||.|.|:.. ||........|.||.||..|...||.|||..:.::.|
  Rat   963 FGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLE 1027

  Fly   937 PY--EQLIIPTCNRNDI-AHLKEYRNAL 961
            .:  ||::.   .|.|: ..|..|||:|
  Rat  1028 KFLTEQMME---RREDVWLPLISYRNSL 1052

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 24/136 (18%)
Stag1XP_006243693.1 RFX5_DNA_bdg 3..>58 CDD:291295
STAG 160..268 CDD:285686 20/119 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62834724
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.