DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and Stag2

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_006257565.1 Gene:Stag2 / 313304 RGDID:1562042 Length:1268 Species:Rattus norvegicus

Alignment Length:1093 Identity:272/1094 (25%)
Similarity:469/1094 (43%) Gaps:184/1094 (17%)


  Fly     3 DISFDDAVLNDSQA--SNQMDFEIREECSIAPNDEPVCVDGTVGDA-TNKSLLQMILSRKRLSPT 64
            :|..|..:|.:|:.  |:..|||..|..:........|..|..|.| ..||...   ..|..|..
  Rat     6 EIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKSGNG---GGKPPSGP 67

  Fly    65 NKRNSH---------------------IESVAKYWGEFYLDSPTAALVALLQFVVEVSGSHYQIP 108
            |:.|.|                     ::||...|.|.|......||:.|:.|.::.||....:.
  Rat    68 NRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVT 132

  Fly   109 DDTSMPFSYSDILSNSSSHF-SNTHIYPLI------RKPADVFVNQVGSFLNALLLVANKFRSDS 166
            .:.......|:|:...:..| .::..|||.      :|....|...:|      :||.....|..
  Rat   133 AEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIG------VLVRQCQYSII 191

  Fly   167 YQLFLVQ-LTNFVMACSESNIRTFRHTATMIGLKIMTIL-------------------------- 204
            |..:::. :.:.:...|:|.:|.||||:|:..:|:||.|                          
  Rat   192 YDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSINMDNTQRQYEAERNKMI 256

  Fly   205 ---------------SDLKSLDDEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQWFARYP 254
                           .:|:...|||. .:...:|..:||.|.||.:.:||.:||.|:|.|...|.
  Rat   257 GKRANERLELLLQKRKELQENQDEIE-NMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMYS 320

  Fly   255 HCHLQPTSLRIFYEALNDGSGDV-IQCSLDNISVLCRKDVLFSEIVALTSEFREILVELCLGKED 318
            ...|..:.|:.....::|..|:| ::| |..:..|.....|.|::...||.|::.:|.:.|.||.
  Rat   321 DAFLNDSYLKYVGWTMHDKQGEVRLKC-LTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEY 384

  Fly   319 AIAEKSVQFLTHFHVLSAEILTDDVCRVLEQLIMAANRGLAQAAAD-----LF---------ILR 369
            .:|.::::.||.....|.|:||.:.|..:..|:.:|:|.:|.||.:     ||         |::
  Rat   385 DVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDGIMK 449

  Fly   370 RNGLDGETFCQRVKHLLQLFIECG-HEQADYLVDSLIDNC--ELVLDWKSMIAVLLENPKSRE-- 429
            |.|..|.. ...||.|:..|:|.. ||.|.|||||:.| |  ||:.||:.|.::|||.|.|.|  
  Rat   450 RRGRQGPN-ANLVKTLVFFFLESELHEHAAYLVDSMWD-CATELLKDWECMNSLLLEEPLSGEEA 512

  Fly   430 LSDIHCSSLIAILLAGVKQATAGEIPPGRYT-------KDLKREPRQGAQERATKCLAPVLPELL 487
            |:|...|:||.|:|..::||.....|.||.|       |:.|.:  ...:.|.|:..|..||:||
  Rat   513 LTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQ--LDDRTRITELFAVALPQLL 575

  Fly   488 RTYANRLQDIERLLELPKYFCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQITVKTLEFL 552
            ..|:...:.:..||:||:||..:.|........|:.|:.....|: ::.:.|.||:...||...|
  Rat   576 AKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIV-EKHTDTDVLEACSKTYHAL 639

  Fly   553 --------NRMIPIPLTK-QLLNSAVTNYKMAWHRTQD--TSPSRSTHNESNRLLATLRLLTVLS 606
                    ||   :.::: ||::.....:.   ...:|  ........:::.::|:||:.:|...
  Rat   640 CNEEFTIFNR---VDISRSQLIDELADKFN---RLLEDFLQEGEEPDEDDAYQVLSTLKRITAFH 698

  Fly   607 GHFNLSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKACFCCLCWDMENLEGTALNNVD 671
            ...:|||||     ||:....|.:..:.|| |:|.:.....|:.....:.|.:..:..:.....|
  Rat   699 NAHDLSKWD-----LFACNYKLLKTGIENG-DMPEQIVIHALQCAHYVILWQLAKITESTSTKED 757

  Fly   672 -------MDEYCDVLHHNLEDYLYVTFSLVGKSNTEPLAYPCFSYTCDLFVLHGN-LCGSSNPSI 728
                   |..:|.:..|      |:|     ..|| .:....|:..||:.::..: :.......:
  Rat   758 LLRLKKQMRVFCQICQH------YLT-----NVNT-TVKEQAFTILCDILMIFSHQIMSGGRDML 810

  Fly   729 RSVAHVPSGNELDILEGFLMEH-FLE----LSPSDLMLETNSDQLQRI---RSILTSYLKVVCLG 785
            ..:.:.|..:....|..|:::| |:|    .:.:|...|..:.:::.:   |::|.::.|::...
  Rat   811 EPLVYTPDSSLQSELLSFILDHVFIEQDDDSNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYT 875

  Fly   786 VVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVFPDDTRHAAG 850
            ||....|:..::.|:||:..:||:::.:|....|.:.|..|.|::.:...|:.::..::     |
  Rat   876 VVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQEN-----G 935

  Fly   851 QRALRPAE-FSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELAQKQPTEATKKLP--- 911
            ....|.:. ||.:.|||.|.|.....:.::.||.:..||:.||.|.|    |:|....:..|   
  Rat   936 YNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAF----KEPNPQGESHPPLN 996

  Fly   912 --FLRVLKVFVPLLLVQDKTRILNFFEPYEQLIIPTCNRNDI-AHLKEYRNAL 961
              ||.:|..|...||.|||..:..:.|.:....: :..|.|: ..|..|||:|
  Rat   997 LAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQM-SLRREDVWLPLMSYRNSL 1048

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 26/131 (20%)
Stag2XP_006257565.1 NADB_Rossmann <116..>145 CDD:304358 6/29 (21%)
STAG 157..265 CDD:285686 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62879532
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.